Recombinant Chlamydia trachomatis serovar D Major outer membrane porin, serovar D (ompA)

In Stock
Code CSB-EP671587DSB
Abbreviation Recombinant Chlamydia trachomatis serovar D ompA protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
ompA
Uniprot No.
Research Area
Others
Alternative Names
(MOMP)
Species
Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Source
E.coli
Expression Region
23-393aa
Target Protein Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCATWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENQKTVKAESVPNMSFDQSVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar D (ompA) gets produced in E. coli and spans the complete mature protein sequence from amino acids 23 to 393. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms it reaches greater than 90% purity - a level that appears suitable for research applications where high purity matters.

The Major outer membrane porin (ompA) of Chlamydia trachomatis represents a key element of the bacterial outer membrane. It likely plays an important role in keeping membrane integrity and structure intact. This protein forms a porin that allows small molecules and ions to pass through, and seems essential for the pathogen to survive. Researchers find it valuable because it's involved in studies examining how bacteria cause disease and how pathogens interact with their hosts.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant OmpA protein are unknown and must be considered unverified. OmpA is a major outer membrane protein that typically forms beta-barrel structures and functions as a porin. Correct integration into a membrane is often crucial for its proper folding and function. Expression in the cytoplasm of E. coli, without the specific machinery for outer membrane protein insertion, makes it highly uncertain whether this recombinant version has adopted its correct, native tertiary structure. The presence of tags on both termini further complicates correct folding. Therefore, any application that depends on the protein's native conformation or porin activity is speculative without experimental validation.

1. Immunological Studies and Antibody Development

This recombinant OmpA protein is suitable for use as an immunogen to generate polyclonal or monoclonal antibodies. Both the His and Myc tags facilitate purification and detection during antibody production and screening. The >90% purity is appropriate for immunization protocols. However, it is critical to note that the antibodies generated will be against the linear sequence and the recombinant form of the protein. Their ability to recognize the natively folded, membrane-embedded OmpA protein in C. trachomatis elementary bodies must be empirically confirmed, as the epitopes may be different.

2. Protein-Protein Interaction Studies

The dual tags make this protein practical for pull-down or co-immunoprecipitation experiments to identify potential binding partners. However, a fundamental caveat is that the utility of these assays is entirely dependent on the recombinant protein being correctly folded. If the protein is misfolded, it may not present the correct interaction surfaces. Any interactions identified could be non-specific or irrelevant to its native function, while a negative result could be due to misfolding.

3. ELISA-Based Binding Assays

The dual-tagged recombinant OmpA can be used in ELISA formats. However, the applicability of these assays depends entirely on the goal. It is well-suited for studying antibody interactions (as in Application 1). In contrast, using it to study "binding with host cell receptors" is highly speculative and contingent upon correct folding. The tags provide standardized methods, but they do not ensure that the receptor-binding domains of OmpA are functional. Such studies should not be undertaken without first confirming the protein's native structure.

4. Biochemical Characterization and Stability Studies

This purified recombinant OmpA protein is well-suited for basic biochemical and biophysical characterization, such as molecular weight confirmation, thermal stability profiling, and aggregation state analysis. This application is valid and is largely independent of the protein's native bioactivity, as it focuses on intrinsic physical properties. The high purity supports accurate measurements for these purposes.

Final Recommendation & Action Plan

The immediate and critical priority is to attempt to assess the protein's structural state, as its function as a porin is likely compromised due to cytoplasmic expression. Techniques like circular dichroism to check for beta-sheet content (characteristic of the beta-barrel) or limited proteolysis to assess folding compactness should be employed before any functional studies. Applications 1 and 4 are the most feasible starting points, as they do not strictly require native folding. Applications 2 and 3, which rely on specific, native interactions, should be considered highly uncertain and should not be pursued as primary goals without evidence of correct structure. Generating antibodies against this recombinant protein (Application 1) is a valid strategy, but their effectiveness for detecting native OmpA must be tested separately.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.; Permits diffusion of specific solutes through the outer membrane.
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Chlamydial porin (CP) (TC 1.B.2) family
Database Links

KEGG: ctr:CT_681

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*