Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

In Stock
Code CSB-EP706579RMS
Abbreviation Recombinant Rickettsia conorii ompA protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
ompA
Uniprot No.
Research Area
Microbiology
Alternative Names
ompA; RC1273; Outer membrane protein A; 190 kDa antigen; Cell surface antigen; rOmp A; rOmpA) [Cleaved into: 120 kDa surface-exposed protein; 120 kDa outer membrane protein OmpA); 32 kDa beta peptide]
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Source
E.coli
Expression Region
1734-2021aa
Target Protein Sequence
DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.8kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rickettsia conorii Outer membrane protein A (ompA) is expressed in E. coli with an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag. This partial protein covers amino acid region 1734-2021 and appears to achieve high purity levels exceeding 85% based on SDS-PAGE verification. The product is intended for research applications, providing what seems to be a dependable tool for scientists examining this particular ompA protein segment.

Outer membrane protein A (ompA) from Rickettsia conorii likely plays a critical role in bacterial cell membrane function. It contributes to structural integrity and may be important for interactions with host environments. Scientists frequently investigate this protein when studying pathogenicity and host-pathogen dynamics, which makes it an attractive research target in infectious disease and microbiology work.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Rickettsia conorii ompA fragment is expressed in E. coli, a prokaryotic system that is generally suitable for producing bacterial outer membrane proteins. As both Rickettsia and E. coli are prokaryotes, the protein has a reasonable probability of proper folding. However, the expressed fragment (1734-2021aa) represents only a partial sequence (288aa) of the full-length ompA, and contains dual tags (N-terminal 10xHis-SUMO and C-terminal Myc) that may interfere with native protein structure. Outer membrane proteins typically require specific folding pathways and membrane integration for proper function. While E. coli can express bacterial membrane proteins, the partial nature and tags may affect correct folding. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation.

1. Antibody Development and Immunoassay Research

This recombinant OmpA fragment is suitable for use as an immunogen to generate polyclonal or monoclonal antibodies. The dual tags provide flexible options for purification and detection during antibody screening. The >85% purity is adequate for immunization protocols. However, it is crucial to understand that the antibodies generated will be against the linear epitopes of this non-native fragment. Their ability to recognize the full-length, correctly folded, and membrane-embedded OmpA protein in Rickettsia conoriiis very low and requires rigorous validation. The primary utility of these antibodies will be for detecting the denatured protein (e.g., in Western blots) or the recombinant immunogen itself in ELISA.

2. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

This application requires caution. While the dual tags enable technical feasibility for pull-down assays, if ompA is misfolded or improperly structured due to the partial sequence and tags, it may not interact physiologically with true binding partners. Outer membrane proteins require precise conformation for specific interactions with host cell receptors or other bacterial components. This application should only be pursued after confirming proper folding through biophysical characterization.

3. ELISA-Based Binding and Recognition Studies

This application is feasible for detection purposes but has limitations for functional studies. The tags enable technical development of ELISA formats, but if ompA is misfolded, binding studies may not reflect biological reality. The assay may work for antibody detection, but requires validation against properly folded ompA for accurate biological interaction studies.

4. Comparative Immunoblot Analysis of Rickettsial Proteins

This application is appropriate as a detection tool. The recombinant ompA can serve as a positive control and molecular weight standard for Western blot analysis. The dual tags provide multiple detection options. However, the migration pattern may differ from native ompA due to the tags and potential folding differences.

Final Recommendation & Action Plan

Given that ompA is a bacterial protein expressed in a prokaryotic system, but with a partial sequence and tags, recommend first performing validation studies: 1) Biophysical characterization (size-exclusion chromatography, circular dichroism) to assess folding state; 2) If possible, comparison with full-length ompA or native protein from Rickettsia cultures; 3) Functional validation of membrane binding or adhesion properties if applicable. Antibody development and use as a detection standard can proceed as relatively safe applications. For interaction studies, await proper folding confirmation and include appropriate controls such as known binding partners. Always validate findings with native ompA when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Why aa 1734-2021 were selected for expression? What is the function of this region of the protein?

A:
Thanks for your inquiry. The region 1734-2021 corresponds to Autotransporter domain which has been purchased by other customers before.
In molecular biology, an autotransporter domain is a structural domain found in some bacterial outer membrane proteins.
The domain is always located at the C-terminal end of the protein and forms a beta-barrel structure.
The barrel is oriented in the membrane such that the N-terminal portion of the protein, termed the passenger domain, is presented on the cell surface.
These proteins are typically virulence factors, associated with infection or virulence in pathogenic bacteria.
Passenger domains structurally characterized to date have been shown to be dominated by a protein fold known as a beta helix, typified by pertactin.
The folding of this domain is thought to be intrinsically linked to its method of outer membrane translocation.
If you have interest in other expression region, please consult with us and we will evaluate if we can provide your specified expression region.

Target Background

Function
Elicits protective immunity.
Subcellular Location
[Outer membrane protein A]: Periplasm.; [120 kDa surface-exposed protein]: Secreted. Cell surface. Note=Surface exposed. This bacterium is covered by a S-layer with hexagonal symmetry.; [32 kDa beta peptide]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane.
Protein Families
Rickettsiae OmpA/OmpB family
Database Links

KEGG: rco:RC1273

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*