Recombinant Human Clusterin (CLU), partial

In Stock
Code CSB-EP005595HU1
Abbreviation Recombinant Human CLU protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
40; AAG 4; AAG4; Aging associated protein 4; Aging-associated gene 4 protein; AI893575; APO J; Apo-J; APOJ; ApoJalpha; ApoJbeta; Apolipoprotein J; ApolipoproteinJ; CLI; CLU; CLU1; CLU2; CLUS_HUMAN; Clusterin alpha chain; Clusterin; Clusterin beta chain; Complement associated protein SP 40 40; Complement associated protein SP 40; Complement associated protein SP40; Complement cytolysis inhibitor a chain; Complement cytolysis inhibitor; Complement cytolysis inhibitor b chain; Complement lysis inhibitor; Complement-associated protein SP-40; D14Ucla3; Dimeric acid glycoprotein; Glycoprotein 80; Glycoprotein III; GP80; Ku70-binding protein 1; KUB 1; KUB1; MGC24903; NA1/NA2; RATTRPM2B; SGP 2; SGP2; SP 40; SP40; Sugp-2; Sulfated glycoprotein 2; Testosterone repressed prostate message 2; Testosterone-repressed prostate message 2; TRPM 2; TRPM-2; TRPM2; TRPM2B; Trpmb
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-224aa
Target Protein Sequence
DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as extracellular chaperone that prevents aggregation of non native proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Protects cells against apoptosis and against cytolysis by complement. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5. Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3. Plays a role in the clearance of immune complexes that arise during cell injury.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Promotes cell death through interaction with BCL2L1 that releases and activates BAX.
Gene References into Functions
  1. The plasma levels of septin-9 and clusterin in ovarian cancer patients were abnormally elevated, which might be used as potential candidates of peripheral blood tumor biomarkers for early diagnosis of EOC and septin-9 might be related to distal metastases of EOC. PMID: 29970704
  2. Data suggest that the potential of clusterin and glutathione synthetase (GSH-S) as platelet biomarkers for early detection of colorectal cancer (CRC) could improve existing screening modalities in clinical application. PMID: 28849249
  3. recombinant alpha- and beta-chains exhibit structural and functional differences and differ in their sub-cellular localization. PMID: 28120874
  4. miR-195 improved the sensitivity of resistant prostate cancer cells to docetaxel by suppressing CLU. PMID: 29665645
  5. The VDR/MEG3/Clusterin signaling pathway may serve as potential therapeutic targets and prognosis biomarkers for colorectal cancer patients in future. PMID: 29628342
  6. Meta analysis validated the Alzheimer disease protective association for CLU (rs11136000) variants. PMID: 29504051
  7. that the Clusterin rs11136000 polymorphism C allele is associated with AD susceptibility PMID: 29396813
  8. clusterin promotes growth and invasion in renal cell carcinoma cells in vitro and in vivo through upregulation of S100A4 PMID: 29400663
  9. The results showed that secreted CLU was overexpressed in three hepatocellular carcinoma cell lines. The downregulation of CLU by CLU shRNA synergistically increased Sorafenib sensitivity in the Bel7402 and SMMC7721 cells, and potentiated Sorafenib induced cell apoptosis. PMID: 29436591
  10. Our study showed low clusterin immunostaining in colorectal carcinoma with lack of association with prognostic indicators PMID: 29279586
  11. This study showed that the 1- and 2-year follow-up, generalized estimating equation analyses of Alzheimer's disease patients revealed that high levels of plasma clusterin at baseline were associated with a significantly larger decrease in Mini-Mental State Examination compared with low levels of plasma clusterin. PMID: 29169407
  12. plasma level decreases in healthy but not in asthmatic pregnancy and correlates directly with lung function PMID: 29200898
  13. Downregulation of apoE and apoJ in CSF strongly suggests a critical role of lipid metabolism in the development and progression of Moyamoya disease. PMID: 28843803
  14. Our study may help to further elucidate the development and progression of non-small cell lung cancer , also it may contribute to the research of therapies targeting sCLU. PMID: 28954633
  15. Using global proteomic profiling of brain leptomeningeal arteries, this study revealed that clusterin and tissue inhibitor of metalloproteinases-3 increase in leptomeningeal arteries affected by cerebral amyloid angiopathy. PMID: 27543695
  16. The presence of microbial invasion of the amniotic cavity, intra-amniotic inflammation (IAI), and microbial-associated IAI was characterized by lower amniotic fluid clusterin concentrations in pregnancies complicated by preterm prelabor rupture of membranes. PMID: 27806672
  17. Our meta-analysis demonstrated that the rs9331888/C> G polymorphism in the clusterin gene might contribute to Alzheimer disease susceptibility especially in Caucasian populations. PMID: 28168383
  18. these findings revealed that CLU genotypes could probably modulate the cerebral the Abeta loads on imaging and volume of hippocampus PMID: 27229352
  19. No association for CLU with Alzheimer's disease in south-Indian population. PMID: 28558900
  20. we confirm that a PEX/Alzheimer's Disease associated risk variant, rs2279590, resides within an enhancer element and regulates the expression of three candidate genes CLU, PTK2B and EPHX2, which were previously known to be modulators in the progression of Alzheimer's Disease. PMID: 28973302
  21. Silencing the expression of CLU could improve the anticancer efficacy of CPT. PMID: 28064403
  22. Thus, we suggest that a combination of PI3K/AKT/mTOR inhibitors with V-ATPase inhibitors might be an effective approach for NSCLC treatment. PMID: 29253572
  23. plasma clusterin was associated with lower volume of the entorhinal cortex, an area that atrophies early in AD. Clusterin could be informative as part of a multi-component preclinical marker for AD PMID: 29324756
  24. This study demonstrated that Apo J expression preferentially occurs in neurons in brain in patient with Alzheimer's Disease. PMID: 27197790
  25. Hippocampal shape features derived from the diffeomorphic metric-based shape analysis led to the identification of significant CLU-PICALM interaction effects on hippocampal morphology in young healthy adults, which were not identified by volume measurement and voxel-wise analysis. PMID: 27017968
  26. CLU-C allele contrubutes to architectural disruptions in resting-state networks in amnestic mild cognitive impairment (aMCI) subjects (i.e., individuals with elevated risk of AD). PMID: 26899953
  27. A total of 249 epileptic patients and 289 healthy controls were included in this study. Three Clusterin single nucleotide polymorphisms (SNPs: rs11136000, rs9314349, and rs9331949) were selected and genotyped with the SNaPshot assay. Our study failed to detect an association between Clusterin polymorphisms (rs11136000, rs9314349, and rs9331949) and epilepsy in a Han Chinese population. PMID: 28972394
  28. Subarachnoid hemorrhage is associated with immediate decrease in CSF clusterin concentrations. PMID: 28803177
  29. Serum ApoJ levels are closely correlated with the magnitude of insulin resistance. PMID: 28986164
  30. data confirm that the association of psoriatic disease with some comorbidities, especially metabolic and cardiovascular disease, might support the correlation with increased circulating Clu. PMID: 28958138
  31. blood platelets have a role in amyloid-beta aggregation in cerebral vessels through integrin alphaIIbbeta3-induced outside-in signaling and clusterin release PMID: 27221710
  32. The results identify Clusterin as a new molecular partner involved in apoptotic cell efferocytosis and suggest a protective role for Clusterin in inflammation and autoimmune diseases. PMID: 27148688
  33. CLU as novel and promising biomarker for prognosis in patients with chronic HF PMID: 28391884
  34. FRET and co-IP assays demonstrated that Clu interacted with beta-amyloid peptide, a pathological protein of AD, which suggested a potential effect of SelR and Abeta with the aid of Clu. The interaction between SelR and Clu provides a novel avenue for further study on the mechanism of SelR in AD prevention. PMID: 23805218
  35. The findings of this study provided further evidence for the CLU risk variant as a candidate gene for Alzheimer disease and may serve as a pre-clinical neuroimaging phenotype of late-onset Alzheimer disease. PMID: 27396407
  36. Study demonstrate high concentrations of clusterin (CLU) in mucus samples and significantly reduced CLU levels in cases with endometriosis receiving contraception compared to cases with endometriosis without contraception. PMID: 27071964
  37. Risk-reducing clusterin genotypes protect against the consequences of poor vascular health on executive function performance and change in older adults without dementia. PMID: 27143425
  38. Addition of the minor allele for rs670139 (MS4A4E), rs9331896 (CLU), and rs12155159 (NME8) was nominally associated with change on the DWRT, DSST, and WFT, respectively, in whites. For rs670139 and rs9331896 the association was only significant in individuals bearing at least one APOE 4 allele in stratified analyses. PMID: 27781389
  39. CLU expression is related to the cellular type and inversely correlated with the presence of lymph node metastases in medullary thyroid carcinoma. PMID: 28411179
  40. Melittin is capable of suppressing tumor growth and promoting gemcitabine sensitivity in pancreatic ductal adenocarcinomas by downregulating cholesterol pathway gene CLU. PMID: 28428074
  41. Data show that ELOVL7, SOCS3, ACSL4 and CLU were upregulated while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group. PMID: 27928700
  42. Both CLU and PLXNA4 have been genetically associated with Alzheimer disease (AD) risk and our data thus provide a direct relationship between two AD risk genes. Our data suggest that increasing the levels of PLXNA4 or targeting CLU-PLXNA4 interactions may have therapeutic value in AD. PMID: 27378688
  43. Although further studies are required to determine how clusterin suppresses non-specific cellular uptake in phagocytes, our data suggest that clusterin plays a key role in the stealth effect of not only pegylated nanoparticles but also non-pegylated nanoparticles. PMID: 27983983
  44. the initial rapid aggregation of LDL(-) is apparently counterbalanced by the stabilizing effects of minor proteins such as apoA-I and apoJ. These results help identify key determinants for LDL aggregation, fusion and coalescence into lipid droplets in vivo. PMID: 27233433
  45. The rs9331888 "GG" genotype in patients and the "CC" genotype in controls were significantly higher in non-4 allele carriers of APOE The haplotype analysis showed the CLU "GCG" haplotype was a risk haplotype. PMID: 27076484
  46. Study explored the common effects of the clusterin (CLU) rs11136000 variant on the default mode network (DMN) in amnestic mild cognitive impairment (aMCI) subjects and remitted geriatric depression (RGD) subjects. The CLU rs11136000 variant could consistently affect the changing of DMN patterns of aMCI and RGD subjects in the frontal cortex. PMID: 28233427
  47. Findings indicate that in Alzheimer's disease, clusterin increases, particularly in regions with most abundant Abeta, but because the increase does not match the rising level of Abeta42, the molar ratio of clusterin : Abeta42 in those regions falls, probably contributing to Abeta deposition within the tissue PMID: 27248362
  48. possible local regulatory role for clusterin in the adipose tissue rather than its systemic involvement in the regulation of energy homeostasis PMID: 27070750
  49. Study identified significant association of the CLU rs9331888 polymorphism with Alzheimer's disease susceptibility in Caucasian population but not in East Asian population (Meta-analysis). PMID: 25633098
  50. Our results suggest clusterin plays a role in modulating the inflammatory response of acute and chronic traumatic brain injury and that it is a useful marker for TBI, particularly in cases with short survival times. Its prominent accumulation in astrocytes, alongside a mounting inflammatory response and activation of microglial cells supports a potential role in the neurodegenerative changes that occur as a result of TBI. PMID: 27365216

Show More

Hide All

Subcellular Location
[Isoform 1]: Secreted.; [Isoform 4]: Cytoplasm.; [Isoform 6]: Cytoplasm.; Nucleus. Cytoplasm. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Microsome. Endoplasmic reticulum. Mitochondrion. Mitochondrion membrane. Cytoplasm, perinuclear region. Cytoplasmic vesicle, secretory vesicle, chromaffin granule.
Protein Families
Clusterin family
Tissue Specificity
Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain,
Database Links

HGNC: 2095

OMIM: 185430

KEGG: hsa:1191

STRING: 9606.ENSP00000315130

UniGene: Hs.436657

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*