Code | CSB-RP060294h |
Product Type | Recombinant Protein |
Size |
US$162Purchase it in Cusabio online store (only available for customers from the US) |
Uniprot No. | P10909 |
Lead Time | 3-7 business days |
Relevance | Isoform 1 functions as Extracellular domain chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complent. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation |
Image | |
Storage Buffer | Tris-based buffer,50% glycerol |
Alias | Aging-associated gene 4 protein;Apolipoprotein J ;Apo-JComplement cytolysis inhibitor ;CLIComplement-associated protein SP-40,40Ku70-binding protein 1NA1/NA2Testosterone-repressed prostate message 2 ;TRPM-2 |
Species | Homo sapiens (Human) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Sequence | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR |
Research Area | Apoptosis |
Source | E.coli |
Gene Names | CLU |
Expression Region | 23-224aa |
Tag Info | N-terminal 6xHis-tagged |
Mol. Weight | 27.8kDa |
Protein Description | Partial |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. |
Subcellular Location | Isoform 1: Secreted, Note=Can retrotranslocate from the secretory compartments to the cytosol upon cellular stress, SUBCELLULAR LOCATION: Nucleus, Cytoplasm, Mitochondrion membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytosol, Microsome, Endoplasmic reticulum, Cytoplasmic vesicle, secretory vesicle, chromaffin granule |
Protein Families | Clusterin family |
Tissue Specificity | Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain, |
Database Links |
HGNC: 2095 OMIM: 185430 KEGG: hsa:1191 STRING: 9606.ENSP00000315130 UniGene: Hs.436657 |
Pathway | Complement and coagulation cascades |
CLU Antibodies for Homo sapiens (Human)
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA005595GA01HU | CLU Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
CSB-PA06029C0Rb | CLU Antibody, FITC conjugated | Human | ELISA |
CSB-PA06029D0Rb | CLU Antibody, Biotin conjugated | Human | ELISA |
CSB-PA06029B0Rb | CLU Antibody, HRP conjugated | Human | ELISA |
CSB-PA001725 | CLU Antibody | Human,Mouse,Rat | WB,IHC,IF,ELISA |
CSB-PA117475 | CLU Antibody | Human | ELISA,IHC |
CLU Antibodies for Human
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA06029A0Rb | CLU Antibody | Human | ELISA, IHC, IF |
CLU Proteins for Homo sapiens (Human)
Code | Product Name | Source |
---|---|---|
CSB-YP005595HU CSB-BP005595HU CSB-MP005595HU |
Recombinant Human Clusterin(CLU) | Yeast Baculovirus Mammalian cell |
CSB-EP005595HU | Recombinant Human Clusterin(CLU) | E.coli |
CLU ELISA Kit for Homo sapiens (Human)
Code | Product Name | Sample Types | Sensitivity |
---|---|---|---|
CSB-E09121h | Human clusterin,CLU ELISA Kit | serum, plasma, cell culture supernates, saliva, urine | 0.78 ng/mL |
Recombinant Human Proteasome activator complex subunit 1(PSME1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Tumor necrosis factor ligand superfamily member 6(FASLG),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Myeloid leukemia factor 1(MLF1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Zaire ebolavirus Envelope glycoprotein(GP),partial
Express system: E.coli
Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.