Recombinant Anopheles gambiae Protein white(w)

Code CSB-CF634625BZL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q27256
Storage Buffer Tris-based buffer,50% glycerol
Species Anopheles gambiae (African malaria mosquito)
Sequence MTINTDDQYGDAESKTTISSSRRYSSSSYQDQSMDDALNTTLTNDKATLIQVWKPKSYGS VKGQIPQCERLTYTWKEIDVFGEAPTDGKPREPLCTRLRNCCTRQRKDFNPRKHLLKNVT GVAKSGELLAVMGSSGAGKTTLLNALAFRSPPGVKISPNAVRALNGVPVNAEQLRARCAY VQQDDLFIPSLTTREHLLFQAMLRMGRDVPASVKQHRVQEVLQELSLVKCADTIIGAPGR IKGLSGGERKRLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVLKGMAMKGKTIILTI HQPSSELYCLFDKILLVAEGRVAFLGSPYQSAEFFSQLGIPCPPNYNPADFYVQMLAIAP AKEAECRDMIKKICDSFAVSPIAREVLETASVAGKGMDEPYMLQQVEGVGSTGYRSSWWT QFYCILWRSWLSVLKDPMLVKVRLLQTAMVATLIGSIYFGQVLDQDGVMNINGSLFLFLT NMTFQNVFAVINVFSAELPVFLREKRSRLYRVDTYFLGKTIAELPLFIAVPFVFTSITYP MIGLRTGATHYLTTLFIVTLVANVSTSFGYLISCASSSISMALSVGPPVVIPFLIFGGFF LNSASVPAYFKYLSYLSWFRYANEALLINQWSTVVDGEIACTRANVTCPRSEIILETFNF RVEDFALDIACLFALIVLFRLGALLCLWLRSRSKE
Source in vitro E.coli expression system
Gene Names w
Protein Names Recommended name: Protein white
Expression Region 1-695
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Database Links

KEGG: aga:AgaP_AGAP000553

STRING: 7165.AGAP000553-PA

Related Products

w Proteins

w Proteins for Anopheles gambiae (African malaria mosquito)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.