Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)

Code CSB-CF301685PQD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P69611
Storage Buffer Tris-based buffer,50% glycerol
Species Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV)
Sequence MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV
Source in vitro E.coli expression system
Gene Names E
Protein Names Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): ORF 3 Protein 4 Protein X1
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the viral envelope that plays a central role in virus morphogenesis and assembly. It is sufficient to form virus-like particles. Seems to be important for creating the membrane curvature needed to acquire the rounded, stable and infectious particle phenotype. Acts as a viroporin, inducing the formation of hydrophilic pores in cellular membranes. Also induces apoptosis (By similarity).
Subcellular Location Virion membrane, Single-pass type III membrane protein, Host Golgi apparatus membrane, Single-pass type III membrane protein
Protein Families Alphacoronaviruses E protein family

Related Products

E Proteins

E Proteins for Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.