Recombinant Anopheles albimanus Protein white(W)

Code CSB-CF613710AKR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q16928
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Anopheles albimanus (New world malaria mosquito)
Sequence MTINTDDQYADGESKTTISSNRRYSTSSFQDQSMEDDGINATLTNDKATLIQVWRPKSYG SVKGQIPAQDRLTYTWREIDVFGQAAIDGKSREPLCSRLRHCFTRQRLVKDFNPRKHLLK NVTGVARSGELLAVMGSSGAGKTTLLNELAFRSPPGVKISPNAIRTLNGVPVTAEQMRAR CAYVQQDDLFIPSLTTKEHLMFQAMLRMGRDVPATPIKMHRVDEVLQELSLVKCADTIIG VAGRVKGLSGGERKRTAFRSETLTDPHLLLCDEPTSSLDSFMAQSVLQVLKGMAMKGKTI ILTIHQPSSELYCLFDRILLVAEGVAFLGSPYQSADFFSQLGIPCPPNYNPADFYVQMLA IAPNKETECRETIKKICDSFAVSPIARDIIETASQVNGDGGIELTRTKHTTDPYFLQPME GVDSTGYRASWWTQFYCILWRSWLSVLKDPMLVKVRLLQTAMVASLIGSIYFGQVLDQDG VMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLREKRSRLYRVDTYFLGKTIAELPLF IAVPFVFTSITYPMIGLKAAISHYLTTLFIVTLVANVSTSFGYLISCASSSISMALSVGP PVVIPFLIFGGFFLNSASVPAYFKYLSYLSWFRYANEALLINQWADHRDGEIGCTRANVT CPASGEIILETFNFRVEDFALDIGCLFALIVLFRLGALFCLWLRSRSKE
Source in vitro E.coli expression system
Gene Names W
Protein Names Recommended name: Protein white
Expression Region 1-709
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily

Related Products

W Proteins

W Proteins for Anopheles albimanus (New world malaria mosquito)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.