Recombinant Vesicular stomatitis Indiana virus Glycoprotein G(G)

Code CSB-CF356071VBJ
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names G
Uniprot No. P03522
Alternative Names GGlycoprotein
Species Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)
Expression Region 17-511
Target Protein Sequence KFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTAIQVKMPKSHKAIQADGWMCH ASKWVTTCDFRWYGPKYITQSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVT DAEAVIVQVTPHHVLVDEYTGEWVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSN LISMDITFFSEDGELSSLGKEGTGFRSNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMA DKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPV DLSYLAPKNPGTGPAFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERELWDDW APYEDVEIGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDD ESLFFGDTGLSKNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTK KRQIYTDIEMNRLGK
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Attaches the virus to host LDL receptors, inducing clathrin-dependent endocytosis of the virion.
Gene References into Functions
  1. Vesicular stomatitis virus G protein complex with two distinct cysteine-rich domains (CR2 and CR3) of LDL-R. PMID: 29531262
  2. This work reveals the range of glycoprotein G structural changes and suggests that G monomers can re-associate, through antiparallel interactions between fusion domains, into dimers that play a role at some early stage of the fusion process. PMID: 28188244
  3. NSF deficiency in HeLa cells barely affected cell viability, anterograde trafficking of vesicular stomatitis virus glycoprotein G and transferrin endocytosis. PMID: 27995606
  4. MARCH8 is highly expressed in terminally differentiated myeloid cells, and that it is a potent antiviral protein that targets viral envelope glycoproteins and reduces their incorporation into virions. PMID: 26523972
  5. Pepscan mapping of autophagy-inducing linear determinants of glycoproteins viral hemorrhagic septicemia virus and glycoproteins vesicular stomatitis virus showed that peptides located in their fusion domains induce autophagy PMID: 25046110
  6. Overall, these results showed that the HIV Env membrane-proximal external region could functionally substitute for the vesicular stomatitis virus G-stem region implying that both perform similar functions even though they are from unrelated viruses. PMID: 24597516
  7. Authors show that D268, located in the segment consisting of residues 264 to 273, which refolds into postfusion helix F during G structural transition, is the major pH sensor while D274, D395, and D393 have additional contributions. PMID: 25210175
  8. Recombinant VSV with RABV-G drives strong expression of transgenes and spreads rapidly from neuron to neuron in only a retrograde manner. PMID: 23403489
  9. Energetic analyses revealed weakened interaction between Domain IV and the protein core at pH 5, which can be attributed to two pairs of structurally neighboring conserved and differentially protonated residues in the Domain IV-core interface. PMID: 22806964
  10. set of recombinant VSV particles bearing lethal mutations in G; study confirms hydrophobic fusion loops are critical for membrane fusion; underscores importance of the sequence elements surrounding the hydrophobic tips of fusion loops in driving fusion PMID: 21680501
  11. Data suggest that BMP preferentially affects the ability of VSV G to mediate lipid mixing during membrane fusion. PMID: 21333650
  12. adaptation of VSIV-6.8 to pHs 6.6 and 6.4 resulted in additional amino acid substitutions in areas of the glycoprotein that were not previously implicated in attachment or fusion. PMID: 15731252
  13. crystal structure; structure of G in its low-pH form shows the classic hairpin conformation observed in all other fusion proteins in their postfusion conformation PMID: 16840692
  14. structure of the prefusion form, determined to 3.0 angstrom resolution, shows that the fusogenic transition entails an extensive structural reorganization of G PMID: 17289996
  15. We now report that VSV glycoprotein G (gpG) is essential for the induction of a previously unrecognized CD14/TLR4-dependent response PMID: 17292937
  16. results suggest a new model of virus assembly in which an interaction of VSV nucleocapsids with G-protein-containing microdomains is a precursor to the formation of viral budding sites PMID: 18367537

Show More

Hide All

Subcellular Location Virion membrane, Single-pass type I membrane protein, Host membrane, Single-pass type I membrane protein
Protein Families Vesiculovirus glycoprotein family
Database Links

KEGG: vg:1489834

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1