Recombinant Human Proto-oncogene c-Rel (REL), partial

Code CSB-YP019552HU
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transcription
Alternative Names
Avian reticuloendotheliosis ; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL ; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog ; V rel reticuloendotheliosis viral oncogene homolog (avian)
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
3-616aa
Target Protein Sequence
SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
66.6 kDa
Protein Length
Partial of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.
Gene References into Functions
  1. The results of this study suggest a possible association of cow's milk proteins allergy with cRel G+7883T polymorphism PMID: 29336650
  2. TAB1 was identified as a functional target of miR-134, and the expression of TAB1 was increased by the transcription factors of NF-kappaB1, c-Rel, and ELK1 via miR-134. PMID: 28206956
  3. NOD2 up-regulates TLR2-mediated IL-23p19 expression via increasing c-Rel activation in Paneth cell-like cells PMID: 27563808
  4. this study show that inhibition of c-Rel expression by siRNA reduced cord blood-derived B-, T-, and NK cell differentiation and expansion PMID: 28090796
  5. Findings emphasize the importance of c-REL-signaling in a cellular model of cervical cancer particularly in terms of proliferation and resistance to chemotherapeutic agents. PMID: 28767691
  6. genetic association studies in population in India: Data suggest that common polymorphisms (SNPs) in CHGA promoter are associated with cardiometabolic disorders; c-Rel has a role in activating CHGA promoter haplotype 2 (variant T alleles at -1018 and -57 bp) under basal and pathophysiological conditions. (CHGA = chromogranin A; c-Rel = c-Rel proto-oncogene protein) PMID: 28667172
  7. findings suggest that c-Rel might play a role in promoting the invasion of choriocarcinoma cells through PI3K/AKT signaling PMID: 28259870
  8. miR-574 and REL interfere with apoptosis in prostate cancer stem cells. PMID: 27779701
  9. observations indicate that induced expression of miR-15b is modulated by c-Rel and CREB in response to JEV infection PMID: 26931521
  10. Gene expression levels of Rel were deregulated in 49 B-cell chronic lymphocytic leukemia, 8 B-cell non-Hodgkin's lymphoma, 3 acute myeloid leukemia, 3 chronic myeloid leukemia, 2 hairy cell leukemia, 2 myelodysplastic syndrome, and 2 T-cell large granular lymphocytic leukemia patients in the post-Chernobyl period. PMID: 25912249
  11. The REL rs842647 polymorphism may be a susceptibility factor for Behcet's Disease pathogenesis and skin lesions. PMID: 26784953
  12. analysis of c-Rel nuclear expression and REL amplification and crosstalk between c-Rel and the p53 pathway reveals prognostic roles diffuse large B-cell lymphoma PMID: 26324762
  13. Over-expression of nuclear NF-kappaB1 and c-Rel are strong risk factors associated with chemoresistance and the prognosis of serous epithelial ovarian cancer PMID: 26683819
  14. Thus, our studies support a role for c-Rel in processes crucial for keratinocyte integrity and malignant transformation such as adhesion and migration. PMID: 25842167
  15. c-Rel is a critical mediator of NF-kappaB-dependent TRAIL resistance of pancreatic cancer cells. PMID: 25299780
  16. c-Rel regulates Ezh2 expression in lymphocytes and malignant lymphoid cells in a novel transcriptional network PMID: 25266721
  17. The REL SNP rs9309331 homozygous minor allele was associated with higher LDL levels in rheumatoid arthritis. PMID: 24489016
  18. Data indicate that the NF-kappaB subunit c-Rel is modified and activated by O-GlcNAcylation. PMID: 23982206
  19. Our studies indicate that c-Rel is a key regulator of cell fate decisions in keratinocytes such as cell growth and death and may have a role in epidermal carcinogenesis. PMID: 23892589
  20. The findings confirm the association of early-onset psoriasis with REL (rs13031237). PMID: 23106574
  21. a genetic increase in the activity of the NF-kappaB subunit c-Rel results in protection against cell death in human islets--nuclear factor-kappaB subunit c-Rel. PMID: 19706790
  22. Activation of NF-kappaB p65 and c-Rel may be considered an important regulator of hypersplenism and liver cirrhosis. PMID: 23195252
  23. REL polymorphisms lack association with rheumatoid arthritis in the Tunisian population. PMID: 22459418
  24. UCP4 is a target effector gene of the NF-kappaB c-Rel prosurvival pathway to mitigate the effects of oxidative stress. PMID: 22580300
  25. Kidney allografts from clinical operational tolerance patients show significant cellular infiltrates but a distinct expression of proteins involved in the NFkappaB1/c-rel pathway. PMID: 22955189
  26. c-Rel, as a member of the Rel/NF-kappaB family, is associated with psoriatic arthritis. PMID: 22170493
  27. IRF-4 was shown to enhance the c-Rel-dependent binding and activation of the interleukin-4 (IL-4) promoter region. IL-2 production was also enhanced by exogenously-expressed IRF-4 and c-Rel. PMID: 21890374
  28. Nuclear factor kappaB subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated beta-interferon production via induction of transcriptional repressor protein YY1. PMID: 22065573
  29. Levels of c-Rel directly modulated expression of caspase-4 as well as other endoplasmic reticulum stress genes. PMID: 21984918
  30. By a novel, reversible dynamic mechanism TNF-alpha-induced c-REL/DeltaNp63alpha interactions inactivate tumor suppressor TAp73 function, promoting TNF-alpha resistance & cell survival in cancers with mtTP53. PMID: 21933882
  31. TAK1-c-Rel and IRF4 pathways play distinct roles in the maintenance of IL-9-producing Th17 phenotype of HTLV-1-transformed cells PMID: 21498517
  32. Three ulcerative colitis susceptibility loci are associated with primary sclerosing cholangitis and indicate a role for IL2, REL, and CARD9. PMID: 21425313
  33. Data show that Foxp3 directly or as part of a multimeric complex engages with the NF-kappaB component c-Rel. PMID: 21490927
  34. IL-23 induction by beta-glucans is due to activation of c-Rel associated with Ser-10-histone H3 phosphorylation in the il23a promoter mediated by MAPK and SAPK or PKA, and inhibition of il12a transcription PMID: 21402701
  35. Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel. PMID: 21283787
  36. the described effect of REL rs13031237 on the predisposition for rheumatoid arthritis was re-evaluated in a large case-control data set of 23 711 individuals and showed a modest increase in rheumatoid arthritis risk. PMID: 20876593
  37. Three new susceptibility loci at 2p16.1 (rs1432295, REL, 8q24.21 (rs2019960, PVT1 and 10p14 (rs501764, GATA3). PMID: 21037568
  38. CXCR2 signaling is critical in transgenic mice with C-rel-deficient/NFkappaB1-deficient/heterozygous Rela+/- neutrophilia causing spontaneous inflammation. PMID: 20519647
  39. The REL locus is associated with rheumatoid arthritis susceptibility in the UK population PMID: 19945995
  40. characterize the prevalence of REL, BCL11A, and MYCN gains in a consecutive CLL series at the time of diagnosis; (ii) define the prognostic relevance of REL, BCL11A, and MYCN gains in CLL. PMID: 20575024
  41. c-Rel, but not nuclear factor-kappa B1 (NFKB1), is required for development of transgenic regulatory T cell progenitors. PMID: 20228198
  42. The kinetics of NFkappaB subunit activation are partly responsible for the observed pattern of acute inflammation in the adenoviral-infected cornea. PMID: 20038977
  43. REL rather than BCL11A may be the target of the 2p13 alterations in classical Hodgkin Lymphoma. PMID: 11830502
  44. REL has an important pathologic role in Hodgkin's lymphoma PMID: 12478664
  45. The correlation of structural aberrations of the REL locus & nuclear c-Rel accumulation in Reed-Sternberg cells qualifies REL as a target gene of the frequent gains in 2p in cHL. REL aberrations contribute to constitutive NF-kappa B/Rel activation in cHL. PMID: 12511414
  46. calmodulin binds c-Rel and RelA after their release from I kappa B and can inhibit nuclear import of c-Rel while letting RelA translocate to the nucleus and act on its target genes PMID: 12556500
  47. v-REL has a role in NF-kappaB-regulated cell death PMID: 12588973
  48. Deletion of either C-terminal transactivation subdomains enhances the in viitro transforming activity of REL in chicken spleen cells. PMID: 14534540
  49. REL amplification may not be causative in diffuse large B-cell lymphoma PMID: 14615382
  50. Rel/NF-kappaB factors could take part in the occurrence of senescence by generating an oxidative stress. PMID: 14744759

Show More

Hide All

Subcellular Location
Nucleus.
Database Links

HGNC: 9954

OMIM: 164910

KEGG: hsa:5966

STRING: 9606.ENSP00000295025

UniGene: Hs.631886

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*