Recombinant Human Nucleolin (NCL), partial

Code CSB-EP015535HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015535HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP015535HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP015535HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
C23; FLJ45706; MS1116 ; NCL; Nucl; NUCL_HUMAN; Nucleolin; Protein C23
Species
Homo sapiens (Human)
Expression Region
2-482aa
Target Protein Sequence
VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS
Mol. Weight
54.4kD
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nucleolin is the major nucleolar protein of growing eukaryotic cells. It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in pre-rRNA transcription and ribosome assembly. May play a role in the process of transcriptional elongation. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats.
Gene References into Functions
  1. Data show that NCL phosphorylation offers specificity to its protein-protein, protein-RNA interactions, resulting in the PARN deadenylase regulation, and hence gene expression, during cellular stress responses. PMID: 29168431
  2. Depletion of endogenous NCL in cells by siRNA targeting during H5N1 infection resulted in significantly increased viral polymerase activity. PMID: 29974255
  3. nucleolin interacts with the viral nucleoprotein PMID: 27373907
  4. This review focus on the contribution of nucleolin for cancer disease and on the development of therapeutic strategies targeting this protein. [review] PMID: 29650282
  5. Results found that prostate circulating tumor cells (CTCs) as a population have an increased level of total nucleolin expression compared to white blood cells. Additionally, there was a distinct nucleolin staining pattern and localization in CTCs. PMID: 28153390
  6. this results show that nucleolin increases colony formation and anchorage-independent growth of ErbB2-overexpressing cells, and that nucleolin overexpression in ErbB2-positive breast cancer patients is associated with reduced patient survival rates and increased disease-risk PMID: 27542246
  7. C23 has a role in promoting tumorigenesis via suppressing p53 activity PMID: 27506938
  8. NCL was associated with bipolar disorder. PMID: 28195573
  9. Nucleolin both forms an mRNP complex with the eIF4G and CSF-1 mRNA, and is co-localized with the eIF4G in the cytoplasm further supporting nucleolin's role in translational regulation. PMID: 28131007
  10. Identified the regulator of ribosome production nucleolin (NCL) as over-expressed in AML blasts. Moreover, we found in two series that high NCL mRNA expression level was associated with a poor overall survival, particular in elderly patients. PMID: 28103300
  11. Data suggest a 216-nucleotide proximal cis-element in LIF mRNA exhibits mRNA destabilizing potential; on exposure to carcinogen PMA (phorbol-12-myristate-13-acetate), this cis-element exhibits mRNA stabilizing activity. PMA induces nucleo-cytoplasmic translocation of both nucleolin and PCBP1, 2 trans-acting factors that bind to and stabilize LIF mRNA. [LIF = leukemia inhibitory factor; PCBP1 = poly(rC) binding protein 1] PMID: 28512205
  12. Data suggest that C11orf98 microprotein, NPM1, and nucleolin interact and colocalize in the cell nucleolus. (C11orf98 = chromosome 11 open reading frame 98 protein; NPM1 = nucleophosmin 1) PMID: 28589727
  13. nucleolin inhibition is a new anti-pancreatic cancer therapeutic strategy that dually blocks tumor progression and normalizes tumor vasculature in pancreatic ductal adenocarcinoma PMID: 27754848
  14. It has been found that during microtubule growth phases, nucleolin affects both the speed and life time of microtubule polymerization. PMID: 27309529
  15. Interaction of Host Nucleolin with Influenza A Virus Nucleoprotein in the Early Phase of Infection Limits the Late Viral Gene Expression PMID: 27711134
  16. A yeast display library based on an engineered IgG1 CH2 scaffold with diversified loop regions was constructed, and CH2 binders were isolated by panning against nucleolin. PMID: 28202413
  17. A portion of HS-anMan colocalized with nucleolin at small discrete sites, while most of the nucleolin and nascent RNA was dispersed. In U87 cells, HS-anMan, nucleolin and nascent RNA reassembled after prolonged hypoxia. PMID: 28300561
  18. our findings identified a novel role of NCL in influenza virus life cycle and established NCL as one of the host cell surface proteins for the entry of influenza A virus. PMID: 27085069
  19. C23 on the cell surface may be a kind of indispensable component in activation of EGFR signaling, by which C23 can participate in the growth and invasion of cervical tumors PMID: 26254615
  20. These data suggest that nucleolin could be an effective treatment target and prognostic factor for patients with non-small cell lung cancer PMID: 26846099
  21. These findings demonstrate that nucleolin expression is down-regulated by miR-194 and miR-206 and upregulated by HuR. PMID: 27221739
  22. Nucleolin overexpression is associated with ependymoma. PMID: 26615563
  23. Nucleolin stabilizes oncostatin-M mRNA by binding to a GC-rich element in its 3'UTR. PMID: 26399567
  24. Data show that nucleolin (NCL) antagonist N6L inhibits cell growth with different sensitivity depending to NCL localization. PMID: 26540346
  25. HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage. PMID: 26238070
  26. These results suggested a clear link between nucleolin expression (including cell membrane nucleolin) and the stem cell-like phenotype in breast cancer, namely in the triple negative molecular subtype. PMID: 26283155
  27. Identification of NCL as a prominent host factor capable of binding with high affinity to the G4 structures present in the LTR promoter of HIV-1. PMID: 26354862
  28. NCL overexpression is involved in liver carcinogenesis. PMID: 25938538
  29. NCL is implicated in the initiation and transduction of EGFR and CXCR4 signaling in the esophageal squamous cell carcinomas.NCL is expressed in the esophageal squamous cell carcinoma tissues with metastasis in the cell membrane, cytoplasm and nucleus. PMID: 25631630
  30. Data suggest that NCL (nucleolin) is re-localized during lytic KSHV (Kaposi sarcoma-associated herpesvirus) infection and protects IL6 (interleukin-6) mRNA from SOX (KSHV cytoplasmic mRNA-specific endonuclease) degradation in cytoplasm. PMID: 25965334
  31. The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.Expression of nucleolin and CCR6 correlates with overall survival in hepatocellular carcinoma patients. PMID: 25698534
  32. C23 protein meditates bone morphogenetic protein-2-mediated epithelial-to-mesenchymal transition via up-regulation of Erk1/Erk2 and Akt in gastric cancer.Correlations between C23, BMPRII expression and prognosis of gastric cancer patients. PMID: 25698539
  33. study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1 PMID: 26183533
  34. Inhibition of C23 expression was shown to increase the radiosensitivity of NSCLC cells, as implied by the relevance to the notably decreased DNA-PKcs phosphorylation activity at the S2056 and T2609 clusters. PMID: 25921135
  35. the multiple functions of NCL that are associated to its multiple cellular localization can participate to the development of cancer. PMID: 25866190
  36. Nucleolin down-regulation is involved in ADP-induced cell cycle arrest in S phase and cell apoptosis in vascular endothelial cells. PMID: 25290311
  37. This study uncovered a new role for nucleolin in restricting microtubule nucleation and anchoring at centrosomes in interphase cells. PMID: 25590348
  38. C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T PMID: 26231209
  39. Increasing expression of nucleolin may be associated with aggressive characteristics of human hepatocellular carcinoma. PMID: 25230759
  40. Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells PMID: 24991885
  41. Data show that nucleolin and endogenous galectin-3 exist in the same complexes in the nucleolus, the cytoplasm, and on the cell surface of melanoma cells. PMID: 25169435
  42. Induced expression of NCL with mutated CK2 phosphorylation sites stabilizes p53, results in higher expression of Bcl2 (B-cell lymphoma 2) homology 3 (BH3)-only apoptotic markers and causes a dominant-negative effect on cell viability. PMID: 25313645
  43. Combined inhibition of nucleolin and ras prevents EGFR activation in glioblastoma cells, additively reducing tumorigenicity. PMID: 25261371
  44. nucleolin may interact with more G protein-coupled receptors, at least chemokine receptor. Our study will lay a new foundation for cancer therapy by antagonizing nucleolin and CXCR4. PMID: 25326811
  45. Studies identify nucleolin as an unconventional epigenetic regulator in leukemia cells and demonstrate nucleolin-NFkappaB-DNMT1 axis as a new molecular pathway underlying AML leukemogenesis. PMID: 25015109
  46. Nucleolin was overexpressed in HCCLM9 cells at the protein and mRNA level. So nucleolin is a novel potential biomarker for the metastasis of hepatocellular carcinoma and a possible therapeutic target for the treatment of hepatocellular carcinoma patients. PMID: 24927373
  47. results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity. PMID: 25561743
  48. this study identified a novel role of the cleavage form of NCL generated by MMP7 in stabilizing MMP9 mRNA. PMID: 24632608
  49. Authors show that the largely nuclear P-protein isoform P3 can localize to nucleoli and forms specific interactions with nucleolin. PMID: 25428867
  50. Transient nucleolar localization of FMRP underlies a strong nucleocytoplasmic translocation, in a complex with nucleolin in order to regulate translation of its target mRNAs. PMID: 24658146

Show More

Hide All

Subcellular Location
Nucleus, nucleolus. Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Database Links

HGNC: 7667

OMIM: 164035

KEGG: hsa:4691

STRING: 9606.ENSP00000318195

UniGene: Hs.79110

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1