Recombinant Mouse Angiogenin (Ang)

In Stock
Code CSB-YP001703MO
Abbreviation Recombinant Mouse Ang protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ang
Uniprot No.
Research Area
Cancer
Alternative Names
(Angiogenin-1)(Ribonuclease 5)(RNase 5)
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
25-145aa
Target Protein Sequence
QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Angiogenin (Ang) comes from a yeast expression system and covers the complete mature protein sequence, spanning amino acids 25-145. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels above 90%, which appears adequate for most research purposes. This product is designed strictly for research applications and maintains low endotoxin levels - something that may help ensure more consistent experimental results.

Angiogenin represents a key protein in angiogenesis, the biological process where new blood vessels grow from existing ones. The protein is recognized for its ribonucleolytic activity and seems to play an important role in vascular development and wound healing processes. Scientists also examine angiogenin's involvement in cellular activities like cell proliferation and migration, which makes it an interesting target for cancer and neurological studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

That N-terminal 6xHis tag allows for nickel-affinity based pull-down experiments to hunt down potential binding partners. Researchers can attach the protein to nickel-coated beads or columns, then mix it with cell lysates or purified protein libraries to trap interacting molecules. This method appears particularly useful for investigating angiogenin's molecular interactions in mouse-specific research settings. The >90% purity level should be sufficient for these binding studies, since minor contaminants are unlikely to mess with specific protein-protein interactions.

2. Antibody Development and Validation

This recombinant mouse angiogenin may work well as an immunogen for creating mouse angiogenin-specific antibodies, or as a standard for testing existing antibodies. The high purity (>90%) and complete mature protein structure suggest it could be suitable for immunization protocols in rabbits or other host animals. Scientists can also use the His-tagged protein in ELISA-based screening to identify and characterize antibody specificity and binding strength. It might serve as a positive control in Western blotting and immunoprecipitation experiments targeting mouse angiogenin.

3. Comparative Species-Specific Biochemical Analysis

Mouse-specific angiogenin can be compared side-by-side with human or other mammalian angiogenin variants to explore species-specific differences in protein behavior. Scientists can run comparative binding tests, stability studies, and structural analyses to understand how angiogenin function has evolved across different species. The yeast expression system provides a eukaryotic folding environment that likely preserves more native-like protein shapes. These kinds of studies may reveal important information about what angiogenin properties have stayed the same or changed across mammalian species.

4. Protein Stability and Folding Studies

Researchers can use the recombinant mouse angiogenin for biophysical characterization studies to examine protein stability, folding kinetics, and thermal properties. Methods like differential scanning calorimetry, circular dichroism spectroscopy, and dynamic light scattering can help characterize the protein's structural features. The His-tag makes protein purification and concentration adjustments easier for these analytical techniques. Such studies may provide fundamental insights into mouse angiogenin's biophysical properties and could help determine the best storage and handling conditions for research work.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
Gene References into Functions
  1. ANG plays a non-cell-autonomous role in regulation of hematopoiesis by simultaneously preserving hematopoietic stem/progenitor cells stemness and promoting myeloid-restricted progenitor cell proliferation. PMID: 27518564
  2. angiogenin and ILK signaling pathway plays a pivotal role in mediating the inhibitory effects of RI on melanoma cells growth PMID: 24769129
  3. Our data provide new insights into the paracrine activities of angiogenin in the nervous system, and further highlight the critical role of non-neuronal cells in the pathogenesis of Amyotrophic lateral sclerosis PMID: 22496549
  4. RNase 4 and RNase 5/ang 1 are unique among the RNase A ribonuclease genes in that they maintain a complex gene locus that is conserved across species with transcription initiated from tissue-specific dual promoters followed by differential exon splicing. PMID: 15722482
  5. ANG plays an important role in neurite pathfinding and this has implications for amyotrophic lateral sclerosis. PMID: 17468498
  6. Angiogenin mRNA was expressed in murine skin in a hair-cycle dependent manner, with maximum levels observed at the late anagen. PMID: 18936943
  7. All three types of the ANG inhibitor suppress rRNA transcription of the prostate luminal epithelial cells and inhibit AKT-induced PIN, indicating an essential role of ANG in AKT-mediated cell proliferation and survival. PMID: 19258415
  8. Murine angiogenin mRNA and protein are upregulated in motoneurons in response to hypoxia, and that Hypoxia-Inducible Factor 1 is sufficient and required to upregulate angiogenin expression during hypoxia. PMID: 19444281

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle lumen. Secreted. Nucleus, nucleolus.
Protein Families
Pancreatic ribonuclease family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*