Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP322803BJK |
| Product Type | Recombinant Protein |
| Size |
US$2466Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P15777 |
| Relevance | S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Bovine coronavirus (strain Mebus) (BCoV) (BCV) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT |
| Research Area | Microbiology |
| Source | E.coli |
| Gene Names | S |
| Protein Names | E2 Peplomer protein |
| Expression Region | 326-540aa |
| Tag Info | N-terminal 10xHis-tagged |
| Mol. Weight | 27.2 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. |
| Subcellular Location | Spike protein S2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly, Some S oligomers may be transported to the plasma membrane, where they may mediate cell-cell fusion (By similarity), SUBCELLULAR LOCATION: Spike protein S1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Peripheral membrane protein |
| Protein Families | Betacoronaviruses spike protein family |
S Antibodies for Bovine coronavirus
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA322803LA01BJK | S Antibody | Bovine coronavirus | ELISA, WB |
| CSB-PA322803LB01BJK | S Antibody, HRP conjugated | Bovine coronavirus | ELISA |
| CSB-PA322803LC01BJK | S Antibody, FITC conjugated | Bovine coronavirus | ELISA |
| CSB-PA322803LD01BJK | S Antibody, Biotin conjugated | Bovine coronavirus | ELISA |
S Proteins for Bovine coronavirus (strain Mebus) (BCoV) (BCV)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP322803BJK CSB-BP322803BJK CSB-MP322803BJK |
Recombinant Bovine coronavirus Spike glycoprotein(S) ,partial | Yeast Baculovirus Mammalian cell |
Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-complex protein 1 subunit zeta(CCT6A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Diacylglycerol kinase alpha(DGKA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cyclin-dependent kinase 4 inhibitor D(CDKN2D)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human LIM domain transcription factor LMO4(LMO4)
Express system: E.coli
Species: Homo sapiens (Human)
