Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']
Species
Bovine coronavirus (strain Mebus) (BCoV) (BCV)
Expression Region
326-540aa
Target Protein Sequence
PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
E.coli-expressed bovine coronavirus (BCoV) spike glycoprotein (S) CSB-CSB-EP322803BJK is a recombinant fusion protein of partial BCoV-S (326-540AA) coupled to a 10xHis-tag at the N-terminus. This protein is calculated molecular weight of 11.9 kDa. It was validated by the LC-MS/MS analysis. The SDS-PAGE showed an about 30 kDa molecular weight of this protein and determined the purity of over 85%. This recombinant BCoV-S protein is in-stock now.
The interaction between S protein and the host receptor mediates the viral and cellular membranes, which is essential for CoV entry into target cells. The S protein is a class-I viral fusion protein and a vital target for antibody neutralization and vaccine development. Each monomer of the trimeric S protein consists of the S1 subunit and S2 subunit. The S1 is responsible for receptor binding and recognition, while S2 possesses all fusion machinery required for membrane fusion. S1 can be subdivided into four domains: N-terminal galectin-like domain (NTD)17, C-terminal domain (CTD), subdomain-1 (SD-1), and subdomain-2 (SD-2). Either NTD or CTD or both can serve as the receptor-binding domain (RBD). BCoV uses their NTDs to bind either receptor protein or sialic acid.
