CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-EP322803BJK |
Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
E.coli-expressed bovine coronavirus (BCoV) spike glycoprotein (S) CSB-CSB-EP322803BJK is a recombinant fusion protein of partial BCoV-S (326-540AA) coupled to a 10xHis-tag at the N-terminus. This protein is calculated molecular weight of 11.9 kDa. It was validated by the LC-MS/MS analysis. The SDS-PAGE showed an about 30 kDa molecular weight of this protein and determined the purity of over 85%. This recombinant BCoV-S protein is in-stock now. The interaction between S protein and the host receptor mediates the viral and cellular membranes, which is essential for CoV entry into target cells. The S protein is a class-I viral fusion protein and a vital target for antibody neutralization and vaccine development. Each monomer of the trimeric S protein consists of the S1 subunit and S2 subunit. The S1 is responsible for receptor binding and recognition, while S2 possesses all fusion machinery required for membrane fusion. S1 can be subdivided into four domains: N-terminal galectin-like domain (NTD)17, C-terminal domain (CTD), subdomain-1 (SD-1), and subdomain-2 (SD-2). Either NTD or CTD or both can serve as the receptor-binding domain (RBD). BCoV uses their NTDs to bind either receptor protein or sialic acid. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | S |
Uniprot No. | P15777 |
Research Area | Microbiology |
Alternative Names | S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2'] |
Species | Bovine coronavirus (strain Mebus) (BCoV) (BCV) |
Source | E.coli |
Expression Region | 326-540aa |
Target Protein Sequence | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 27.2 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 10xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. |
Subcellular Location | Spike protein S2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly, Some S oligomers may be transported to the plasma membrane, where they may mediate cell-cell fusion (By similarity), SUBCELLULAR LOCATION: Spike protein S1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Peripheral membrane protein |
Protein Families | Betacoronaviruses spike protein family |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide