Name: Recombinant Bovine coronavirus Spike glycoprotein (S), partial
Brand: CUSABIO
SKU: CSB-EP322803BJK

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Uniprot No.

P15777

Research Area

Microbiology

Alternative Names

S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']

Species

Bovine coronavirus (strain Mebus) (BCoV) (BCV)

Source

E.coli

Expression Region

326-540aa

Target Protein Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.2 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

E.coli-expressed bovine coronavirus (BCoV) spike glycoprotein (S) CSB-CSB-EP322803BJK is a recombinant fusion protein of partial BCoV-S (326-540AA) coupled to a 10xHis-tag at the N-terminus. This protein is calculated molecular weight of 11.9 kDa. It was validated by the LC-MS/MS analysis. The SDS-PAGE showed an about 30 kDa molecular weight of this protein and determined the purity of over 85%. This recombinant BCoV-S protein is in-stock now.

The interaction between S protein and the host receptor mediates the viral and cellular membranes, which is essential for CoV entry into target cells. The S protein is a class-I viral fusion protein and a vital target for antibody neutralization and vaccine development. Each monomer of the trimeric S protein consists of the S1 subunit and S2 subunit. The S1 is responsible for receptor binding and recognition, while S2 possesses all fusion machinery required for membrane fusion. S1 can be subdivided into four domains: N-terminal galectin-like domain (NTD)17, C-terminal domain (CTD), subdomain-1 (SD-1), and subdomain-2 (SD-2). Either NTD or CTD or both can serve as the receptor-binding domain (RBD). BCoV uses their NTDs to bind either receptor protein or sialic acid.

Target Background

Function

attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.

Subcellular Location

Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Protein Families

Betacoronaviruses spike protein family

Code	CSB-EP322803BJK
Abbreviation	Recombinant Bovine coronavirus S protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322803BJK could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) (BCoV) (BCV) S. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322803BJK could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) (BCoV) (BCV) S.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage