Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

In Stock
Code CSB-EP3388GND
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.Predicted band size: 13.9 kDa
    Observed band size: 15 kDa due to molecular structure of protein
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Microbiology
Alternative Names
Non-structural protein 9
Species
Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Source
E.coli
Expression Region
1-113aa
Target Protein Sequence
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
13.9 kDa
Protein Length
Full length
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) non-structural protein 9 (NSP9) is a full-length protein expressed in E.coli. It contains the 1-113 amino acid sequence of human SARS-CoV-2 and carries a 10xHis-tag at the C-terminus. The purity of this NSP9 protein reaches up to 90% determined by SDS-PAGE. And it migrated to a molecular band of about 15 kDa on the gel under reducing conditions. Moreover, this NSP9 protein is in stock now. In addition to being as the immunogen for specific antibodies, this recombinant NSP9 protein may also be used in the studies of microbiology.

SARS-CoV-2 NSP9 is a small nonenzymatic protein that is not incorporated within the viral particles. As an RNA-binding protein, NSP9 assists with RNA-dependent RNA polymerase function, facilitating viral genomic RNA reproduction and viral replication during infection. It also mediates viral overall virulence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*