Code | CSB-EP3388GND |
Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) non-structural protein 9 (NSP9) is a full-length protein expressed in E.coli. It contains the 1-113 amino acid sequence of human SARS-CoV-2 and carries a 10xHis-tag at the C-terminus. The purity of this NSP9 protein reaches up to 90% determined by SDS-PAGE. And it migrated to a molecular band of about 15 kDa on the gel under reducing conditions. Moreover, this NSP9 protein is in stock now. In addition to being as the immunogen for specific antibodies, this recombinant NSP9 protein may also be used in the studies of microbiology. SARS-CoV-2 NSP9 is a small nonenzymatic protein that is not incorporated within the viral particles. As an RNA-binding protein, NSP9 assists with RNA-dependent RNA polymerase function, facilitating viral genomic RNA reproduction and viral replication during infection. It also mediates viral overall virulence. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprot No. | YP_009742616.1 |
Research Area | Microbiology |
Alternative Names | Non-structural protein 9 |
Species | Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) |
Source | E.coli |
Expression Region | 1-113aa |
Target Protein Sequence | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 13.9 kDa |
Protein Length | Full length |
Tag Info |
C-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.