Recombinant Mouse Linker for activation of T-cells family member 1 (Lat)

Code CSB-CF012767MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Lat; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38
Species
Mus musculus (Mouse)
Expression Region
1-242
Target Protein Sequence
MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
Gene References into Functions
  1. LatY136F knock-in mice displayed increased production of Th2-type IgG1 (a homologue of human IgG4) and developed multiple organ tissue lesions reminiscent of those seen in patients with of immunoglobulin G4-related disease (IgG4-RD). The development of these tissue lesions was highly sensitive to corticosteroid treatment like in IgG4-RD. LatY136F knock-in mouse strain represents a promising model for human IgG4-RD. PMID: 29902238
  2. this study shows that the site-specific delivery of linker for activation of T cells (LAT) in asthmatic mouse model PMID: 28063403
  3. IFT20 is required for the delivery of the intracellular pool of LAT to the immune synapse in naive primary T lymphocytes. PMID: 26715756
  4. provide evidence that CD28 and the TCR complex regulate NF-kappaB via different signaling modules of GRB-2/VAV1 and LAT/ADAP pathways respectively. PMID: 25455592
  5. low level of LAT-PLC-gamma1 interaction was associated with Th2 polarized differentiation, and this may contribute to the etiology of asthma. PMID: 24978613
  6. These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppression PMID: 24595757
  7. Sos1 has distinct roles in acting as a scaffold to oligomerize the adaptor protein LAT, and in guanine nucleotide exchange activity PMID: 24222714
  8. this analysis identified 65 proteins not associated before with the Zap70-Lat-SLP-76 network and thus should provide cues for future functional experiments. PMID: 24584089
  9. Data suggest that transmembrane adaptor protein LAT-PLCgamma1 (Phospholipase C gamma 1) signaling may function differently in various subsets of gammadelta T cells. PMID: 24523509
  10. chemotaxis toward antigen is controlled in mast cells by a cross-talk among FcepsilonRI, tetraspanin CD9, transmembrane adaptor proteins NTAL and LAT, and cytoskeleton-regulatory proteins of the ERM family PMID: 23443658
  11. LAT-mediated signaling is essential for the continuous expansion of CD8 T cells during T cell priming, but is not required for contraction and memory maintenance of CD8 T cells. PMID: 23401587
  12. The lymphoproliferative disease observed in LAT-Y136F mutant mice is at least partially dependent on hyperactivation of Ras. PMID: 23209318
  13. our data suggest that LAT acts as a positive regulator of RANKL-induced osteoclastogenesis. PMID: 22382685
  14. LAT-deficient CTLs failed to upregulate FasL and produce gamma interferon after engagement with target cells and had impaired granule-mediated killing. PMID: 22566687
  15. PECAM-1-mediated inhibition of GPVI-dependent platelet responses result from recruitment of SHP-2-p85 complexes to tyrosine-phosphorylated PECAM-1, which diminishes the association of PI3K with activatory signaling molecules Gab1 and LAT PMID: 20723025
  16. Data implicate that LAT has positive and negative roles in the regulation of mature T cells. PMID: 20837489
  17. While SLP-76 and LAT1 depend on each other for many of their functions, LAT2/SLP-76 interactions and SLP-76-independent LAT1 functions also mediate a positive signaling pathway downstream of FcepsilonRI in mast cells. PMID: 20606011
  18. mouse models revealed that LAT constitutes more than just a positive regulator of TCR signaling and plays a negative regulatory role that contributes to terminate antigen-driven T cell responses [Review] PMID: 20107804
  19. Data indicate that the binding of LAT to PLC-gamma1 is essential for the suppressive function of CD4(+)CD25(+) regulatory T cells. PMID: 20130215
  20. Data show that In quiescent T cells, both TCR and Lat existed in separate membrane domains (protein islands), and these domains concatenated after T cell activation. PMID: 20010844
  21. LAT is required for signaling via the T cell antigen receptor (TCR) PMID: 11901197
  22. inhibitory function for LAT that is critical for the differentiation and homeostasis of TH cells PMID: 12065839
  23. critical role for integrated PLC-gamma1 and Ras-Erk signaling through LAT in T cell development and homeostasis PMID: 12065840
  24. LAT colocalizes with 2B4 in glycolipid-enriched microdomains of the plasma membrane, is a required intermediate for 2B4 signal transduction, and plays a role in 2B4-mediated cytotoxicity. PMID: 12077228
  25. adaptor proteins LAT and SLP-76 are involved in pre-BCR signaling, thereby rescuing arrested murine SLP-65(-/-) pre-B cells PMID: 12932362
  26. The four distal tyrosines of this protein are required for signaling in FcepsilonRI-mediated mast cell activation. PMID: 12953098
  27. LAT is an essential regulator of T cell homeostasis and terminal differentiation. PMID: 12970761
  28. Vav1 transduces TCR signals to Ras by controlling recruitment of RasGRP1 to the membrane and recruitment of Sos1 and -2 to the transmembrane adapter protein LAT. PMID: 14764585
  29. LAT controls its own recruitment at the immune synapse, where it is required as a scaffold protein for the signalling machinery. PMID: 14996932
  30. LAT tyrosines differentially contribute to exocytosis and cytokine secretion and differentially regulate biological responses of mucosal- and serosal-type mast cells. PMID: 15470052
  31. The Lat does not completely ablate mast cells responsiveness. PMID: 15745852
  32. Mutation of the phospholipase C-gamma1-binding site of LAT affects both positive and negative thymocyte selection. PMID: 15795236
  33. Role of LAT in the development and function T cells. Review. PMID: 16102570
  34. mouse LAT mutant lacking palmitoylation was unstable and susceptible to degradation via the proteasome pathway. PMID: 16460687
  35. Polyclonal B cell activation in Lat(Y136F) mutant mice is not due to a direct (intrinsic) effect of the Lat mutation on B cells but indirectly results from the presence of CD4 Th2 effector cells. PMID: 16887989
  36. LAT mediates immunoglobulin E-induced sustained Erk activation critical for mast cell survival. PMID: 17420272
  37. activation of phospholipase C gamma 2 via glycoprotein 6 is dependent on 2 complementary events PMID: 17579183
  38. Despite the presence of autoantibodies causative of severe systemic disease, the pathological conditions observed in Lat(Y136F) mice unfold in an Ag-independent manner and thus do not qualify as a genuine autoimmune disorder. PMID: 18209052
  39. Overexpression of either Sp1 or full-length Sp3 was shown to augment LAT promoter activity, while siRNA-mediated knockdown of each transcription factor was demonstrated to have an inhibitory effect. PMID: 18343609
  40. GPVI-FcR gamma-chain, LAT and PLCgamma2 are essential for thrombus generation and stability PMID: 18464161
  41. These data show that natural killer cell immunoreceptor tyrosine-based activation motifs preferentially use a signaling cassette regulated by interplay between LAT and LAB. PMID: 18645037
  42. Gads plays a key role in linking the adapter LAT to SLP-76 in response to weak activation of GPVI and CLEC-2 whereas LAT is required for full activation over a wider range of agonist concentrations. PMID: 18826392
  43. Deletion of the STAT6 transcription factor converts the fulminant T helper(Th)2 cell lymphoproliferative disorder that characterizes LatY136F mice into a fast-onset lymphoproliferative disorder dominated by competent Th1 effectors and CD8 T cells. PMID: 19234162
  44. Supplementation with vitamin E eliminates the age-related differences in LAT phosphorylation in T cells from young and old. PMID: 19403707
  45. Results identify novel functions for both CD8 and LAT during CD8-mediated apoptosis that are independent of TCR signal transduction and suggest a mechanism for signal transduction leading to apoptosis upon CD8 crosslinking. PMID: 19449311
  46. LAT palmitoylation functions primarily as a sorting signal required for its plasma membrane transport PMID: 19592663
  47. Data show that Erk activation was diminished in LAT knock-in Bam32 knockout CD4(+) T cells. PMID: 19667175
  48. The fact that such LAT-independent signals result in lymphoproliferative disorders with excessive cytokine production demonstrates that LAT constitutes a key negative regulator of the triggering module. PMID: 19682930
  49. Results demonstrate a combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a activation to generate inflammation. PMID: 19795417

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts.
Tissue Specificity
Expressed in T-cells and mast cells.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1