Recombinant Bovine coronavirus Spike glycoprotein (S), partial

In Stock
Code CSB-YP340678BJN
Abbreviation Recombinant Bovine coronavirus S protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
S glycoprotein;E2;Peplomer protein
Species
Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Source
Yeast
Expression Region
314-634aa
Target Protein Sequence
TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPKNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFIFHDVNSGTTCSTDLQKSNTDIILGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine coronavirus Spike glycoprotein (S) is produced in a yeast expression system, spanning amino acids 314 to 634 of the protein. This partial protein carries a 6xHis tag at the C-terminus, which helps with purification and detection. The product shows purity levels exceeding 90% when assessed by SDS-PAGE, providing high-quality material for various research applications.

The Spike glycoprotein (S) of Bovine coronavirus appears to play a crucial role in how the virus enters host cells. It enables attachment to cell receptors and the subsequent fusion of viral and cellular membranes—a critical step in the viral life cycle. This protein has become a significant focus in research, helping scientists study virus-host interactions and develop therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant bovine coronavirus spike protein fragment can work as an immunogen for generating polyclonal or monoclonal antibodies specific to the S protein. The C-terminal 6xHis tag allows for straightforward purification and immobilization during antibody screening assays. Researchers may find this protein useful in ELISA-based assays to characterize how antibodies bind and their affinity levels. The high purity (>90%) should provide reliable and reproducible results in immunization protocols and subsequent antibody validation studies.

2. Protein-Protein Interaction Studies

The 6xHis tag makes pull-down assays possible to identify and study potential binding partners of the bovine coronavirus spike protein. Researchers can attach this recombinant protein to nickel-affinity matrices to capture interacting cellular proteins from bovine cell lysates or other relevant biological samples. The defined amino acid region (314-634aa) represents a specific domain that likely contains important binding sites for host cell receptors or other viral proteins. These studies might provide insights into the molecular mechanisms of viral entry and host-pathogen interactions.

3. Structural and Biochemical Analysis

This recombinant protein fragment works well in biophysical studies aimed at characterizing the structural properties of the bovine coronavirus spike protein. The yeast expression system and high purity make it appropriate for techniques like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation. Researchers can investigate protein folding, stability, and conformational changes under different buffer conditions. The C-terminal His tag also allows for controlled protein immobilization in surface plasmon resonance studies or other label-free binding assays.

4. Comparative Coronavirus Research

This bovine coronavirus spike protein fragment appears to be a valuable tool for comparative studies across different coronavirus species. Researchers can pair it with similar recombinant proteins from other coronaviruses to investigate evolutionary relationships and structural conservation within the spike protein family. Cross-reactivity studies using this protein may help identify conserved epitopes or binding domains across coronavirus species. Such comparative analyses contribute to a broader understanding of coronavirus biology and evolution.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*