Recombinant Bovine coronavirus Spike glycoprotein (S), partial

In Stock
Code CSB-YP340678BJN
Abbreviation Recombinant Bovine coronavirus S protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
S glycoprotein;E2;Peplomer protein
Species
Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Source
Yeast
Expression Region
314-634aa
Target Protein Sequence
TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPKNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFIFHDVNSGTTCSTDLQKSNTDIILGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine coronavirus Spike glycoprotein (S) is produced in a yeast expression system, spanning amino acids 314 to 634 of the protein. This partial protein carries a 6xHis tag at the C-terminus, which helps with purification and detection. The product shows purity levels exceeding 90% when assessed by SDS-PAGE, providing high-quality material for various research applications.

The Spike glycoprotein (S) of Bovine coronavirus appears to play a crucial role in how the virus enters host cells. It enables attachment to cell receptors and the subsequent fusion of viral and cellular membranes—a critical step in the viral life cycle. This protein has become a significant focus in research, helping scientists study virus-host interactions and develop therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in a yeast system, which supports native-like folding and partial post-translational modifications (PTMs)—critical for the bovine coronavirus Spike (S) protein fragment (314–634 aa). The C-terminal 6xHis tag minimally disrupts structure, and yeast’s eukaryotic machinery improves solubility compared to prokaryotic systems. However, no direct evidence confirms native secondary/tertiary structure (e.g., circular dichroism for disulfide bonds, thermal shift assays for stability). Yeast may not replicate mammalian-specific glycosylation or disulfide pairing, potentially altering conformation. The fragment’s biological role (e.g., receptor binding, fusion activity) is untested—yeast expression does not guarantee retention of native functional interfaces. Bioactivity (e.g., binding to bovine cell receptors) requires explicit validation.

1. Antibody Development and Characterization

This recombinant S fragment can serve as an immunogen for generating antibodies, but antibody specificity must be validated against native S—yeast folding may present non-native epitopes, leading to cross-reactivity. The His tag simplifies purification/immobilization for ELISA, but antibodies may not recognize the fragment in its native context (e.g., on viral particles).

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify interactors, but results depend on correct folding—yeast-expressed fragments may misfold, causing false positives. Identified partners must be validated via co-IP or functional assays to rule out artifacts. The fragment’s defined region (314–634 aa) supports domain-specific interaction mapping, but bioactivity (e.g., receptor binding) is unconfirmed.

3. Structural and Biochemical Analysis

This fragment supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) but cannot fully represent the native S protein. Yeast’s glycosylation profile differs from mammals, potentially affecting structural dynamics. Conclusions about folding or conformational changes must contextualize yeast-specific PTMs.

4. Comparative Coronavirus Research

This yeast-expressed fragment enables cross-species comparisons, but PTM differences (e.g., glycosylation) may confound results—bovine coronavirus S may fold differently than SARS-CoV-2 or MERS-CoV S. Evolutionary insights require complementary sequence/functional data to account for system biases.

Final Recommendation & Action Plan

This yeast-expressed bovine coronavirus S fragment (314–634 aa) is a viable tool for antibody development or preliminary interaction studies, but requires rigorous validation first, confirm folding via circular dichroism/thermal shift assays to rule out misfolding; second, validate bioactivity (e.g., receptor binding) using co-IP or cell-based assays. Optimize expression (e.g., co-express chaperones) to improve native folding. For structural studies, consider cleaving the His tag to reduce artifacts. If folding/bioactivity fails, switch to a mammalian system (e.g., HEK293 cells) to ensure mammalian-specific PTMs and native conformation—this fragment’s utility for functional studies depends on validating its structural integrity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*