Recombinant Rabies virus Glycoprotein (G), partial

In Stock
Code CSB-EP389005RIE
Abbreviation Recombinant Rabies virus Glycoprotein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
G
Uniprot No.
Alternative Names
Glycoprotein
Species
Rabies virus (strain India) (RABV)
Source
E.coli
Expression Region
20-459aa
Target Protein Sequence
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rabies virus Glycoprotein (G) is expressed in E. coli, covering the amino acid region 20-459. The protein carries an N-terminal 6xHis-SUMO tag, which helps with purification and detection. It appears to reach a purity level of over 90%, as confirmed by SDS-PAGE analysis. This product is intended for research use only, potentially providing reliable results for scientific investigations involving the Rabies virus.

Rabies virus Glycoprotein (G) represents a critical component of the viral envelope. It plays a vital role in virus attachment and entry into host cells. The protein seems essential for inducing virus-neutralizing antibodies, which makes it a key target in vaccine research and development. Its involvement in host-pathogen interactions and immune response modulation may underscore its significance in virology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant rabies virus glycoprotein fragment can serve as an immunogen for generating monoclonal or polyclonal antibodies against rabies virus G protein. The N-terminal His-SUMO tag helps with purification and immobilization for immunization protocols and subsequent antibody screening assays. Researchers might use this protein in ELISA-based screening to identify antibodies with specific binding properties to the G protein region spanning amino acids 20-459. The high purity (>90%) likely ensures minimal contamination that could interfere with immune responses or antibody specificity.

2. Protein-Protein Interaction Studies

Pull-down assays using this His-SUMO tagged recombinant G protein could help identify cellular proteins that interact with rabies virus glycoprotein. The His tag allows immobilization on nickel-based affinity matrices, while the expressed region (20-459aa) appears to contain potential binding domains for host cell receptors or other viral proteins. This approach may prove valuable for mapping the rabies virus interactome and understanding molecular mechanisms of viral entry and pathogenesis at the protein level.

3. Structural and Biochemical Analysis

This recombinant protein fragment provides material for biophysical characterization studies. These might include circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation. Specific proteases can remove the SUMO tag if native protein structure analysis is required. Researchers could investigate the folding properties, stability, and conformational changes of this glycoprotein region under various buffer conditions and temperatures.

4. Vaccine Research and Immunogenicity Studies

Preclinical vaccine development studies might benefit from using this recombinant G protein fragment to evaluate immune responses in animal models. The protein could serve as a subunit vaccine candidate or as a control antigen in comparative immunogenicity studies. Researchers may assess antibody titers, cellular immune responses, and protective efficacy using this well-defined protein fragment with known purity and composition.

5. Diagnostic Assay Development

This recombinant protein appears suitable as a capture or detection antigen in developing research-grade immunoassays for rabies virus detection. The His tag allows oriented immobilization on assay surfaces, which could potentially improve binding efficiency and assay sensitivity. The protein might serve as a positive control or standard in ELISA, Western blot, or other immunoassay formats used in research laboratories studying rabies virus.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.
Subcellular Location
Virion membrane; Single-pass type I membrane protein.
Protein Families
Lyssavirus glycoprotein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*