Recombinant Rabies virus Glycoprotein (G), partial

In Stock
Code CSB-EP389005RIE
Abbreviation Recombinant Rabies virus Glycoprotein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
G
Uniprot No.
Alternative Names
Glycoprotein
Species
Rabies virus (strain India) (RABV)
Source
E.coli
Expression Region
20-459aa
Target Protein Sequence
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rabies virus Glycoprotein (G) is expressed in E. coli, covering the amino acid region 20-459. The protein carries an N-terminal 6xHis-SUMO tag, which helps with purification and detection. It appears to reach a purity level of over 90%, as confirmed by SDS-PAGE analysis. This product is intended for research use only, potentially providing reliable results for scientific investigations involving the Rabies virus.

Rabies virus Glycoprotein (G) represents a critical component of the viral envelope. It plays a vital role in virus attachment and entry into host cells. The protein seems essential for inducing virus-neutralizing antibodies, which makes it a key target in vaccine research and development. Its involvement in host-pathogen interactions and immune response modulation may underscore its significance in virology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rabies virus Glycoprotein (G) is a complex viral envelope protein that requires precise folding, proper disulfide bond formation (with multiple conserved disulfide bonds), glycosylation at specific asparagine residues, and trimerization for its functional activity in receptor binding and viral entry. The E. coli expression system cannot provide the eukaryotic folding environment, oxidative conditions for correct disulfide bond formation, or glycosylation machinery required for this viral glycoprotein. The partial fragment (20-459aa) lacks the complete structural context, and the large N-terminal 6xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's functional domains. The probability of correct folding with functional receptor-binding activity is extremely low.

1. Antibody Development and Characterization

This application has limited utility. While antibodies can be generated against linear epitopes, they may not recognize conformational epitopes of the native, glycosylated glycoprotein. Antibodies raised against this non-glycosylated, prokaryotically expressed fragment will likely not efficiently bind to the authentic viral glycoprotein in its native conformation.

2. Structural and Biochemical Analysis

Basic biophysical analysis can be performed, but will not reflect native glycoprotein structure. The lack of glycosylation and probable incorrect disulfide bonding mean results will describe an artificial protein rather than the authentic viral glycoprotein. The SUMO tag will dominate structural properties.

Final Recommendation & Action Plan

This E. coli-expressed rabies glycoprotein fragment is unsuitable for functional studies due to the essential requirements for glycosylation and proper disulfide bonding that cannot be met in this expression system. The protein cannot be used for interaction studies and vaccine research. Applications 1 and 2 have severe limitations and should only be used for basic research purposes, with the understanding that results will not reflect native glycoprotein biology. For authentic rabies glycoprotein research, use mammalian-expressed, properly glycosylated full-length protein that preserves native conformational epitopes and receptor-binding capability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.
Subcellular Location
Virion membrane; Single-pass type I membrane protein.
Protein Families
Lyssavirus glycoprotein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*