Purity
Greater than 90% as determined by SDS-PAGE.
Species
Rabies virus (strain India) (RABV)
Expression Region
20-459aa
Target Protein Sequence
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
A target DNA fragment corresponding to 20-459aa of Rabies virus (strain India) (RABV) was expressed with N-terminal 6xHis-tags in yeast. The resulting protein is the Yeast-expressed Recombinant Rabies Virus Glycoprotein (G). Its purity is greater than 90% as determined by SDS-PAGE. And it contains 440 amino acids and has a calculated molecular weight of 51.4 kDa. As the only surface protein of the rabies virion, the RABV G protein can induce the production of virus-neutralizing antibodies (VNA).
Rabies virus G is a component constituting the envelope of the rabies virus, which is the causative agent of rabies. Rabies is an ancient zoonotic disease that causes tens of thousands of deaths around the globe annually. RABV G is a key determinant for the induction of innate immune responses and consequent pathogenesis. The binding of RABV G to neural receptors such as acetylcholine receptor or neural cell adhesion molecules (NCAM), leading to exclusive neurotropism and neuroinvasiveness of RABV.
