Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

In Stock
Code CSB-EP857425ARU
Abbreviation Recombinant Avian infectious bronchitis virus N protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein;NC;Protein N
Species
Avian infectious bronchitis virus (strain H52) (IBV)
Source
E.coli
Expression Region
1-409aa
Target Protein Sequence
MASGKAAGKTDAPTPVIKLGGPKPPKVGSSGNVSWFQAIKAKKLNSPPPKFEGSGVPDNENLKPSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAANLNWGDSQDGIVWVAGKGADTKFRSNQGTRDSDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREVSRGRRSGSEDDLIARAARIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPRLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant avian infectious bronchitis virus nucleoprotein (N) is produced in an E. coli expression system and spans the full length of the protein, from amino acids 1 to 409. It features a C-terminal 6xHis-tag for easy purification and detection. The protein achieves a purity greater than 85% as verified by SDS-PAGE, ensuring reliable results for research applications.

The nucleoprotein (N) of the avian infectious bronchitis virus appears to play a crucial role in the virus's replication and assembly processes. It's a structural protein that binds to the viral RNA, forming the ribonucleoprotein complex. This protein seems integral to the study of viral pathogenesis and immune responses, making it an important focus in virology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Avian infectious bronchitis virus Nucleoprotein (N) is prone to forming inclusion bodies (insoluble aggregates) when expressed in E. coli. Even if soluble, the protein may misfold and fail to form correct oligomeric structures essential for its RNA-binding function. While the C-terminal 6xHis tag facilitates purification, it cannot ensure proper folding. Experimental validation is crucial, but negative results only indicate that "this E. coli-expressed preparation lacks activity," not that IBV N protein inherently lacks the function.

1. Antigen for IBV-specific Antibody Development

This application remains viable as antibody development relies on linear epitope availability rather than native folding. Even if misfolded, the protein can generate antibodies against sequence-specific epitopes. However, antibodies may not recognize conformational epitopes of the native protein.

2. Biochemical Characterization and Functional Assays

Characterization can assess basic properties, but functional assays likely yield negative results. Any observed "activity" requires rigorous controls to distinguish genuine function from non-specific effects.

3. ELISA-Based Research Assays

Immunoassays rely on antibody-epitope binding rather than native protein function. The protein can serve as a standard for detection assays regardless of folding status.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally limited for this viral nucleoprotein due to high risks of aggregation and misfolding. This protein is primarily suitable for applications that don't require native folding (Antibody Development and ELISA). Avoid interaction studies due to the high risk of artefacts. If functional studies are attempted, negative results must be interpreted as limitations of the expression system, not inherent properties of IBV N protein. For reliable functional studies, consider alternative expression systems (e.g., mammalian, insect cells) that better support viral protein folding. Always include appropriate controls and acknowledge system limitations when interpreting results.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Gammacoronavirus nucleocapsid protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*