Recombinant Bovine coronavirus Spike glycoprotein (S), partial

In Stock
Code CSB-MP879403BJL
Abbreviation Recombinant Bovine coronavirus S protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
S glycoprotein;E2;Peplomer protein
Species
Bovine coronavirus (strain OK-0514) (BCoV) (BCV)
Source
Mammalian cell
Expression Region
314-634aa
Target Protein Sequence
TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCRPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Bovine coronavirus Spike glycoprotein (S) is produced using a mammalian cell expression system, ensuring proper folding and post-translational modifications. This protein represents a partial sequence from amino acids 314 to 634 and includes a C-terminal 6xHis-tag for simplified purification and detection. The purity level exceeds 85%, as confirmed by SDS-PAGE, which makes it suitable for various research applications.

Bovine coronavirus relies heavily on its Spike glycoprotein (S) to infect host cells. This protein mediates attachment to host cell receptors, playing what appears to be a pivotal role in viral entry and the overall viral life cycle. Research into the structure and function of this protein may be essential for understanding viral pathogenesis and developing therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in a mammalian cell system (e.g., CHO or HEK293 cells), which supports native-like folding and post-translational modifications (PTMs)—including glycosylation—critical for the bovine coronavirus Spike (S) protein fragment (314–634 aa). The C-terminal 6xHis tag minimally disrupts structure, and the full-length S context (though truncated here) improves solubility compared to prokaryotic systems. However, no direct evidence confirms native secondary/tertiary structure (e.g., circular dichroism for disulfide bonds, thermal shift assays for stability) or retention of functional conformations (e.g., receptor-binding domain [RBD] geometry, if present in 314–634 aa). The fragment’s biological role (e.g., receptor binding, fusion activity, or interaction with other viral NSPs) is untested—mammalian expression does not guarantee the fragment retains native functional interfaces.

1. Antibody Development and Characterization

This recombinant S fragment (314–634 aa) can serve as an immunogen for generating antibodies, and mammalian glycosylation may enhance conformational epitope recognition. However, antibody specificity must be validated against native full-length S—the fragment may present non-native epitopes, and antibodies may not cross-react with intact viral particles. The His tag simplifies ELISA screening, but results require confirmation with native protein to ensure relevance.

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify interactors, but results reflect fragment-specific interactions, not full-length S biology—mammalian folding improves native-like binding, but identified partners must be validated via co-IP or functional assays (e.g., replicon assays) to rule out artifacts. The fragment’s defined region supports domain-specific mapping, but broader viral mechanisms remain unaddressed.

3. Structural and Biochemical Characterization

This fragment supports domain-focused biophysical studies (e.g., CD for secondary structure, DLS for stability) and glycosylation analysis (relevant to mammalian expression). However, results cannot be extrapolated to full-length S—truncation may alter oligomerization or conformational dynamics. Limited proteolysis can probe local structure, but interpretation requires caution due to missing domains.

4. Comparative Coronavirus Research

This fragment enables cross-species comparisons (e.g., with SARS-CoV-2 or MERS-CoV S), but findings are fragment-specific—evolutionary insights require complementary full-length protein data to avoid misinterpreting truncation-driven artifacts. Glycosylation differences between species may also confound antigenic comparisons.

Final Recommendation & Action Plan

This mammalian-expressed bovine coronavirus S fragment (314–634 aa) is a strong candidate for antibody development and domain-specific studies but requires rigorous validation first, confirm folding/stability via circular dichroism/thermal shift assays; second, validate bioactivity (e.g., receptor binding, if applicable) using co-IP or cell-based assays; third, for comparative research, pair with full-length proteins to contextualize fragment results. Optimize expression (e.g., use glycoengineered cell lines) to enhance native-like glycosylation. If folding/bioactivity fails, use a viral replication system to produce native protein—this fragment’s utility depends on validating its structural and functional integrity relative to the full-length S protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*