Recombinant Human coronavirus 229E Spike glycoprotein (S), partial

In Stock
Code CSB-EP321366HIT
Abbreviation Recombinant Human coronavirus 229E S protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
E2 Peplomer protein
Species
Human coronavirus 229E (HCoV-229E)
Source
E.coli
Expression Region
785-873aa
Target Protein Sequence
DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTIQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus 229E Spike glycoprotein (S) is produced in E. coli and covers amino acids 785 to 873. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity level exceeds 85%, which should provide reliable results for research work.

The Spike glycoprotein (S) of Human coronavirus 229E appears to play a critical role in how the virus enters cells - it seems to handle both attachment to host cell receptors and the membrane fusion process. This protein has become a key target for researchers looking into viral infection mechanisms and possible therapeutic approaches. Understanding this protein may be crucial for grasping how coronaviruses interact with their hosts and for developing strategies against coronavirus-related diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in E. coli as a partial Spike (S) fragment (785–873 aa) with dual tags (10xHis-N-terminal, Myc-C-terminal). While the His tag improves solubility, E. coli often struggles to produce correctly folded eukaryotic membrane-associated proteins like the S protein—even for fragments. No data confirms native secondary/tertiary structure (e.g., circular dichroism, thermal shift assays). E. coli may misfold the fragment or fail to form critical disulfide bonds (if present in 785–873 aa), leading to non-functional conformations. The fragment lacks the full-length S context (e.g., receptor-binding domain [RBD], fusion machinery), so it cannot recapitulate native interactions (e.g., with ACE2 or other S domains). Bioactivity (e.g., ligand binding, oligomerization) is untested and unlikely to mirror wild-type S.

1. Antibody Development and Epitope Mapping

This recombinant S fragment (785–873 aa) can serve as an immunogen for antibodies targeting this region, but antibody specificity must be validated against native S—E. coli-expressed protein may present non-native epitopes, leading to cross-reactivity. The His/Myc tags simplify purification/detection, but antibodies generated may not recognize the fragment in its native context (e.g., on viral particles or infected cells).

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify interactors, but results are highly dependent on correct folding—E. coli-expressed fragments often misfold, causing false positives/negatives. Identified partners must be validated via co-IP or functional assays to rule out artifacts. The fragment’s limited length (785–873 aa) restricts insights to interactions within this domain, not full-length S biology.

3. ELISA-Based Binding Assays

The dual-tagged protein can be used in ELISA to screen ligand/receptor interactions, but orientation and folding introduce variability—the His tag may force non-native immobilization, and misfolding could abolish binding. Results are qualitative at best; quantitative affinity measurements require confirmed native structure.

4. Structural and Biochemical Characterization

This fragment supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) but cannot inform native S architecture—E. coli-expressed protein may lack correct disulfide bonds or domain folding. Structural conclusions (e.g., oligomerization) must be contextualized by folding limitations.

Final Recommendation & Action Plan

This E. coli-expressed HCoV-229E S fragment (785–873 aa) has limited utility without rigorous validation first, confirming folding via CD spectroscopy and thermal shift assays to rule out misfolding; second, testing bioactivity (e.g., binding to known partners) to ensure native-like function. Optimize expression (e.g., co-express chaperones, lower induction temperature) to improve solubility. For antibody development, validate specificity against native S; for interactions/ELISA, use tag cleavage or orthogonal methods (e.g., SPR) to reduce artifacts. If folding/bioactivity fails, use a eukaryotic system (e.g., insect cells) to ensure native structure—this fragment alone is insufficient for reliable downstream applications without validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Gene References into Functions
  1. Two amino acid substitutions (R642M and N714K) in the S protein of HCoV-229E clinical isolates altered their sensitivity to a cathepsin L inhibitors and their tropism towards endosomes. PMID: 27733646
  2. The highly homologous C-terminal parts of the NL63-S1 subunits in conjunction with distinct amino acids in the central regions of these proteins confer recognition of ACE2 and CD13, respectively. PMID: 16912312
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein.
Protein Families
Alphacoronaviruses spike protein family
Database Links

KEGG: vg:918758

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*