Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial

In Stock
Code CSB-EP663395BFD
Abbreviation Recombinant Bat coronavirus HKU3 S protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
(S glycoprotein)(E2)(Peplomer protein)
Species
Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)
Source
E.coli
Expression Region
310-514aa
Target Protein Sequence
RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S) is produced in E. coli and covers amino acids 310-514. This partial protein carries an N-terminal 6xHis-tag, which streamlines purification and detection processes. SDS-PAGE analysis confirms the product achieves greater than 90% purity, making it well-suited for research work.

The Spike glycoprotein (S) of Bat coronavirus HKU3 appears to play a critical role in how the virus enters cells. It mediates both attachment and fusion between viral and host cell membranes. This makes it a key target for investigating viral infection mechanisms and potentially developing therapeutic interventions. Research into coronavirus-host interactions and viral pathogenesis likely depends on understanding this protein.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Comparative Spike Protein Structure-Function Studies

This recombinant fragment (310-514 aa) from the bat coronavirus HKU3 spike protein may serve as a tool for comparative structural studies, but results must be interpreted with caution due to potential misfolding. The E. coli expression system lacks eukaryotic post-translational modifications and proper disulfide bond formation critical for coronavirus spike protein structure. While techniques like circular dichroism can provide secondary structure information, data from surface plasmon resonance or crystallography may not reflect native conformation. Comparative analyses with other coronavirus spike proteins should be validated with mammalian-expressed controls.

2. Antibody Development and Cross-Reactivity Screening

This protein can generate antibodies, but they may not recognize the native spike protein due to likely misfolding in E. coli. Antibodies developed against this antigen might primarily recognize linear epitopes rather than conformational epitopes present on the authentic viral spike protein. Cross-reactivity studies using this antigen will have limited biological relevance for understanding neutralization or immune recognition of properly folded spike protein.

3. Protein-Protein Interaction Studies

Pull-down assays using this protein are likely to yield non-physiological interactions due to probable misfolding. The inability of the E. coli-expressed protein to adopt correct tertiary structure means identified binding partners may not reflect genuine biological interactions. Any potential receptors identified would require extensive validation with properly folded protein from eukaryotic expression systems.

4. Biochemical Characterization and Stability Studies

This protein is suitable for basic biochemical characterization, but the results will characterize the properties of the misfolded recombinant protein, not the native spike protein. Stability parameters (thermal stability, pH sensitivity) determined using this protein may not translate to the biologically relevant form and could be misleading for understanding actual viral protein behavior.
Final Recommendation & Action Plan
This E. coli-expressed bat coronavirus HKU3 spike protein fragment has significant limitations for biologically meaningful studies due to the high probability of misfolding. Priority should be given to validating the protein's structural state using circular dichroism spectroscopy and comparing it with properly folded standards. For reliable results, consider switching to a eukaryotic expression system (baculovirus or mammalian cells) that can support proper glycosylation and folding. If using this protein, limit applications to initial screening or linear epitope mapping, and clearly acknowledge the folding limitations in all research outcomes. For functional studies, always validate key findings with proteins expressed in more appropriate systems that preserve native spike protein conformation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*