Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial

In Stock
Code CSB-EP336163HIY1
Abbreviation Recombinant Human coronavirus OC43 S protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Others
Alternative Names
E2;Peplomer protein
Species
Human coronavirus OC43 (HCoV-OC43)
Source
E.coli
Expression Region
318-624aa
Target Protein Sequence
TVQPIADVYRRKPNLPNCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNFCPCKLNGSCVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGTYKCPQTKSLVGIGEHCSGLAVKSDYCGGNSCTCRPQAFLGWSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus OC43 Spike glycoprotein (S) is produced in E. coli and spans the 318-624 amino acid region. This partial construct includes a C-terminal 6xHis-tag, which appears to make purification more straightforward. The protein shows a purity level greater than 85% as determined by SDS-PAGE, making it suitable for various research applications. It is intended for research use only and is not for diagnostic or therapeutic purposes.

The Spike glycoprotein of Human coronavirus OC43 plays a crucial role in viral entry into host cells, enabling attachment and fusion processes. It represents a key target for studying viral pathogenesis and immune response mechanisms. Understanding the structure and function of this protein may be essential in virology research, particularly in the context of coronavirus-related studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The E. coli system lacks eukaryotic post-translational modifications (PTMs). While the His tag improves solubility, E. coli struggles to correctly fold eukaryotic membrane-associated proteins like the S protein—critical for functions such as receptor binding or interaction with other viral components. No data confirms native secondary/tertiary structure (e.g., circular dichroism for disulfide bonds, thermal shift assays for stability). E. coli may misfold the fragment, leading to aggregation or non-functional conformations. The fragment lacks full-length S context (e.g., receptor-binding domain [RBD], fusion machinery), so it cannot recapitulate native interactions (e.g., with host receptors like CEACAM1 for OC43). Bioactivity (e.g., ligand binding, oligomerization) is untested and unlikely to mirror wild-type S.

1. Antibody Development and Characterization

This recombinant S fragment can serve as an immunogen for generating antibodies, but antibody specificity must be validated against native S—E. coli-expressed protein may present non-native epitopes, leading to cross-reactivity with irrelevant targets. The His tag simplifies purification/immobilization for ELISA, but antibodies may not recognize the fragment in its native context (e.g., on viral particles).

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify interactors, but results depend on correct folding—E. coli-expressed fragments often misfold, causing false positives/negatives. Identified partners must be validated via co-IP or functional assays (e.g., replicon assays) to rule out artifacts. The partial length restricts insights to interactions within this domain, not full-length S biology.

3. Structural and Biochemical Characterization

This fragment supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) but cannot inform native S architecture—E. coli-expressed protein may lack correct disulfide bonds or domain folding. Structural conclusions (e.g., oligomerization) must be contextualized by folding limitations.

4. ELISA-Based Binding Assays

The His tag enables immobilization for ELISA, but misfolding may alter binding—results are qualitative at best. Quantitative affinity measurements require a confirmed native structure, as the fragment’s conformation may not support native-like interactions.

Final Recommendation & Action Plan

This E. coli-expressed HCoV-OC43 S fragment has limited utility without rigorous validation first, confirming folding via CD spectroscopy and thermal shift assays to rule out misfolding; second, testing bioactivity (e.g., binding to known ligands or host receptors) to ensure native-like function. Optimize expression (e.g., co-express chaperones, use low-temperature induction) to improve solubility. For antibody development, validate specificity against native S; for interactions/ELISA, use tag cleavage or orthogonal methods (e.g., SPR) to reduce artifacts. If folding/bioactivity fails, use a eukaryotic system (e.g., mammalian/insect cells) to ensure native structure—this fragment alone is insufficient for reliable downstream applications without validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection.; attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*