Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial

In Stock
Code CSB-EP336163HIY1
Abbreviation Recombinant Human coronavirus OC43 S protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
E2;Peplomer protein
Species
Human coronavirus OC43 (HCoV-OC43)
Source
E.coli
Expression Region
318-624aa
Target Protein Sequence
TVQPIADVYRRKPNLPNCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNFCPCKLNGSCVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGTYKCPQTKSLVGIGEHCSGLAVKSDYCGGNSCTCRPQAFLGWSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus OC43 Spike glycoprotein (S) is produced in E. coli and spans the 318-624 amino acid region. This partial construct includes a C-terminal 6xHis-tag, which appears to make purification more straightforward. The protein shows a purity level greater than 85% as determined by SDS-PAGE, making it suitable for various research applications. It is intended for research use only and is not for diagnostic or therapeutic purposes.

The Spike glycoprotein of Human coronavirus OC43 plays a crucial role in viral entry into host cells, enabling attachment and fusion processes. It represents a key target for studying viral pathogenesis and immune response mechanisms. Understanding the structure and function of this protein may be essential in virology research, particularly in the context of coronavirus-related studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant HCoV-OC43 spike protein fragment can serve as an immunogen for generating monoclonal or polyclonal antibodies specific to the spike glycoprotein. The C-terminal His-tag appears to simplify purification and immobilization for antibody screening assays. Researchers might use this protein in ELISA-based screening to identify and characterize antibodies that recognize the 318-624 amino acid region of the spike protein. The high purity (>85%) likely makes it suitable for immunization protocols and subsequent antibody validation studies.

2. Protein-Protein Interaction Studies

The His-tagged spike protein fragment can be used in pull-down assays to identify potential cellular receptors or binding partners within the specified amino acid region. The tag enables efficient immobilization on nickel-based affinity matrices for capturing interacting proteins from cell lysates or purified protein libraries. This application could help clarify molecular mechanisms of viral entry or host cell recognition involving this specific domain of the spike protein.

3. Structural and Biochemical Characterization

This purified protein fragment provides material for biophysical studies including circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation to characterize its folding properties and oligomerization state. The defined amino acid boundaries (318-624) make it suitable for limited proteolysis studies and mass spectrometry analysis to map accessible regions and potential cleavage sites. Such studies may provide insights into the structural properties of this specific spike protein domain.

4. ELISA-Based Binding Assays

The His-tagged protein can be used to develop ELISA platforms for studying binding interactions with potential ligands, small molecules, or other proteins of interest. The tag appears to allow consistent protein orientation and immobilization on ELISA plates through anti-His antibodies or nickel-coated surfaces. This standardized approach enables quantitative binding studies and screening applications to investigate molecular interactions involving this spike protein region.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection.; attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*