Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
S; 3Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']
Species
Human coronavirus OC43 (HCoV-OC43)
Expression Region
15-344aa
Target Protein Sequence
VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
E.coli-expressed human coronavirus OC43 (HCoV-OC43) spike glycoprotein (S) CSB-EP336163HIY is a recombinant fusion protein of partial HCoV-OC43-S coupled to a 6xHis-SUMO-tag at the N-terminus. This protein consists of the 15-344AA of HCoV-OC43-S and is calculated molecular weight of 53.9 kDa. The SDS-PAGE determined its purity over 90%. This recombinant HCoV-OC43-S protein is in-stock now.
HCoV-OC43 S protein is essential for viral entry into the host and critically determines the tropism of host and tissue. It mediates the binding to cell-surface receptors. The S protein binds to sugar-based receptor-determinants, specifically to 9-O-acetylated sialic acids (9-O-Ac-Sias) attached as terminal residues to glycan chains on glycoproteins and lipids.
