Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
E; sM; 4; Envelope small membrane protein; E protein; sM protein
Species
Human coronavirus NL63 (HCoV-NL63)
Source
in vitro E.coli expression system
Target Protein Sequence
MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant HCoV-NL63 E protein protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, E protein proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.
The HCoV-NL63 E protein is a small, integral, structural membrane protein found in the lipid envelope of mature virus particles. It functions in various stages of the viral life cycle, such as assembly, budding, envelope formation, and pathogenesis. Absence or inactivation of E protein leads to attenuated viruses because of changes in either virion morphology or tropism. The E protein is abundantly expressed inside the infected cells during the replication cycle, but only a small fraction is integrated into the virion membrane. The majority of the E protein is found in intracellular trafficking sites such as the ER, Golgi, and ERGIC, where it aids in HCoV-NL63 assembly and budding. The E protein also plays an important role in viral production and maturation.