Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Uniprot No.

Q6Q1S0

Research Area

Others

Alternative Names

E; sM; 4; Envelope small membrane protein; E protein; sM protein

Species

Human coronavirus NL63 (HCoV-NL63)

Source

in vitro E.coli expression system

Expression Region

1-77aa

Target Protein Sequence

MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

12.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

18-23 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant HCoV-NL63 E protein protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, E protein proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

The HCoV-NL63 E protein is a small, integral, structural membrane protein found in the lipid envelope of mature virus particles. It functions in various stages of the viral life cycle, such as assembly, budding, envelope formation, and pathogenesis. Absence or inactivation of E protein leads to attenuated viruses because of changes in either virion morphology or tropism. The E protein is abundantly expressed inside the infected cells during the replication cycle, but only a small fraction is integrated into the virion membrane. The majority of the E protein is found in intracellular trafficking sites such as the ER, Golgi, and ERGIC, where it aids in HCoV-NL63 assembly and budding. The E protein also plays an important role in viral production and maturation.

Target Background

Function

Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis.

Subcellular Location

Host Golgi apparatus membrane; Single-pass type III membrane protein.

Protein Families

Alphacoronaviruses E protein family

Database Links

KEGG: vg:2943502

Code	CSB-CF764822HIX
Abbreviation	Recombinant Human coronavirus NL63 Envelope small membrane protein
MSDS	MSDS Datasheet
Size	$1620
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human coronavirus NL63 Envelope small membrane protein (E)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage