Recombinant Human coronavirus NL63 Membrane protein (M)

In Stock
Code CSB-CF757672HIX
Abbreviation Recombinant Human coronavirus NL63 Membrane protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
M
Uniprot No.
Research Area
Immunology
Alternative Names
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Species
Human coronavirus NL63 (HCoV-NL63)
Source
in vitro E.coli expression system
Expression Region
1-226aa
Target Protein Sequence
MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.7kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Human coronavirus NL63 Membrane protein (M) is produced through an in vitro E.coli expression system, yielding a full-length protein of 226 amino acids. The protein carries an N-terminal 10xHis tag, which helps with purification and detection processes. SDS-PAGE analysis confirms a purity exceeding 85%, making it well-suited for various research applications in viral protein studies.

The Membrane protein (M) of Human coronavirus NL63 appears to be a crucial component of the viral envelope. It likely plays a fundamental role in virus assembly and morphogenesis. As an integral membrane protein, it interacts with other structural proteins and contributes to viral particle formation. Understanding the M protein's structure and function may be essential for advancing coronavirus biology research and developing therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human coronavirus NL63 Membrane protein (M) is a triple-pass transmembrane protein whose native structure and function depend on integration into a lipid bilayer. While the in vitro E. coli expression system improves solubility and may support disulfide bond formation, it cannot provide the necessary membrane environment for proper tertiary and quaternary structure formation. The protein may be soluble and contain correct disulfide bonds, but it will lack the transmembrane topology and spatial organization found in viral membranes. The probability of achieving native-like structure and function in solution is low.

1. Antibody Development and Characterization

This application is highly suitable as antibody development primarily relies on antigenic sequence availability rather than native membrane insertion. The full-length protein provides comprehensive epitope coverage for generating antibodies against various M protein regions. Antibodies may recognize both linear and some conformational epitopes, though membrane-dependent epitopes may not be faithfully represented.

2. Biochemical Characterization and Stability Studies

These studies are valuable for assessing the protein's solution properties, but cannot reflect its native membrane-bound state. Techniques can analyze disulfide bonding, oligomerization in solution, and general stability, providing important biophysical data for this specific preparation.

3. Immunoassay Development and Validation

This application is well-suited as immunoassays depend on epitope recognition rather than native conformation. The protein can serve as a reliable standard for detecting anti-M protein antibodies in research assays.

Final Recommendation & Action Plan

The cell-free expressed M protein is primarily suitable for applications that don't require native membrane integration, such as antibody production (Application 1), immunoassay development (Application 3), and biophysical characterization (Application 2). For interaction studies, use with caution and only for investigating potential interactions with soluble viral components, always validating findings with native systems. Avoid any applications requiring authentic transmembrane topology or membrane-dependent interactions. Begin with a comprehensive biophysical characterization to understand this specific preparation's properties, then proceed with antibody and assay development. For studies requiring native M protein function, use membrane-incorporated protein or virus-like particles.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families
Alphacoronaviruses M protein family
Database Links

KEGG: vg:2943503

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*