Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
PA; Polymerase acidic protein; EC 3.1.-.-; RNA-directed RNA polymerase subunit P2
Species
Influenza A virus (strain A/x-31 H3N2)
Expression Region
124-247aa
Target Protein Sequence
RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 124-247 constitute the expression domain of recombinant Influenza A virus PA (Polymerase acidic protein). This PA (Polymerase acidic protein) protein is theoretically predicted to have a molecular weight of 18.6 kDa. The PA (Polymerase acidic protein) protein was expressed in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of PA (Polymerase acidic protein), making it easier to detect and purify the PA (Polymerase acidic protein) recombinant protein in the later stages of expression and purification.
The influenza A virus polymerase acidic protein (PA) is a crucial component of the viral RNA polymerase complex responsible for transcribing and replicating the viral genome. PA, along with polymerase basic proteins (PB1 and PB2), forms the heterotrimeric RNA-dependent RNA polymerase essential for viral replication and transcription. PA possesses endonuclease activity, cleaving host cell mRNA to generate primers for viral RNA synthesis. This cap-snatching mechanism is vital for initiating viral transcription. Additionally, PA plays a role in regulating the switch from viral RNA transcription to replication. Understanding the functions of the influenza A virus PA protein is critical for developing antiviral strategies and vaccines targeting the viral polymerase complex.
