Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

Q9IQ47

Research Area

others

Alternative Names

PA; Polymerase acidic protein; EC 3.1.-.-; RNA-directed RNA polymerase subunit P2

Species

Influenza A virus (strain A/x-31 H3N2)

Source

E.coli

Expression Region

124-247aa

Target Protein Sequence

RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 124-247 constitute the expression domain of recombinant Influenza A virus PA (Polymerase acidic protein). This PA (Polymerase acidic protein) protein is theoretically predicted to have a molecular weight of 18.6 kDa. The PA (Polymerase acidic protein) protein was expressed in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of PA (Polymerase acidic protein), making it easier to detect and purify the PA (Polymerase acidic protein) recombinant protein in the later stages of expression and purification.

The influenza A virus polymerase acidic protein (PA) is a crucial component of the viral RNA polymerase complex responsible for transcribing and replicating the viral genome. PA, along with polymerase basic proteins (PB1 and PB2), forms the heterotrimeric RNA-dependent RNA polymerase essential for viral replication and transcription. PA possesses endonuclease activity, cleaving host cell mRNA to generate primers for viral RNA synthesis. This cap-snatching mechanism is vital for initiating viral transcription. Additionally, PA plays a role in regulating the switch from viral RNA transcription to replication. Understanding the functions of the influenza A virus PA protein is critical for developing antiviral strategies and vaccines targeting the viral polymerase complex.

Target Background

Function

Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity.

Subcellular Location

Host cytoplasm. Host nucleus.

Protein Families

Influenza viruses PA family

Code	CSB-EP881268IIO
Abbreviation	Recombinant Influenza A virus Polymerase acidic protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP881268IIO could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP881268IIO could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Influenza A virus Polymerase acidic protein (PA), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage