Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 (CSB-MP684964PAL), the EC50 is 5.056-7.559 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 7.941-10.49 ng/ml.
Research Area
Microbiology
Alternative Names
(S glycoprotein)(E2)(Peplomer protein)(Spike protein S1)(Spike protein S2)
Molecular Characterization
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Expression Region
306-527aa
Target Protein Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human SARS-CoV spike (S) protein amino acids 306-527 linked an N-terminal 10xHis-tag by the Thrombin linker, as well as a C-terminal Myc tag, was expressed in mammalian cells. The product is the recombinant human SARS-CoV S protein. This SARS-CoV S protein is an active protein, whose activity has been determined through functional ELISA by binding to ACE2 of Paguma larvata and human, with EC50 values of 5.056-7.559 ng/ mL and 7.941-10.49 ng/ mL, respectively. Its purity is high (>95%, SDS-PAGE) and endotoxin is low (<1.0 EU/ug protein, LAL method). Due to the glycosylation, it has an apparent molecular weight of 36 kDa on the gel. It is in stock now.
The SARS-CoV is an enveloped, single, and positive-stranded RNA virus. Its S protein is made up of the S1 subunit and S2 subunit. The S1 subunit contains a receptor-binding domain responsible for the engagement with the host cell receptor ACE2. The S2 subunit mediates the virus-host cell membrane fusion. The S protein plays important role in the induction of neutralizing-antibody and T-cell responses, and protective immunity during SARS-CoV infection.
