Name: Recombinant Human SARS coronavirus Spike glycoprotein(S),partial (Active)
Brand: CUSABIO
SKU: CSB-MP348663HQE

Product Details

Description	May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 (CSB-MP684964PAL), the EC₅₀ is 5.056-7.559 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC₅₀ is 7.941-10.49 ng/ml.
Target Names	S
Uniprot No.	P59594
Research Area	Microbiology
Alternative Names	(S glycoprotein)(E2)(Peplomer protein)(Spike protein S1)(Spike protein S2)
Molecular Characterization
Species	Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Source	Mammalian cell
Expression Region	306-527aa
Target Protein Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Mol. Weight	30 kDa
Protein Length	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function	S1 attaches the virion to the cell membrane by interacting with human ACE2 and CLEC4M/DC-SIGNR, initiating the infection. Binding to the receptor and internalization of the virus into the endosomes of the host cell probably induces conformational changes in the S glycoprotein. Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.; FUNCTION
Subcellular Location	Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein
Protein Families	Betacoronaviruses spike protein family

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP348663HQE
Size	Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 (CSB-MP684964PAL), the EC₅₀ is 5.056-7.559 ng/ml. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC₅₀ is 7.941-10.49 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human SARS coronavirus Spike glycoprotein(S),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage