Recombinant Human coronavirus OC43 Nucleoprotein (N)

In Stock
Code CSB-MP333798HIY
Abbreviation Recombinant Human coronavirus OC43 N protein
MSDS
Size $148
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein
Species
Human coronavirus OC43 (HCoV-OC43)
Source
Mammalian cell
Expression Region
1-448aa
Target Protein Sequence
MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus OC43 Nucleoprotein (N) is produced in a mammalian expression system, which appears to ensure proper folding and post-translational modifications. This full-length protein covers amino acids 1 to 448 and includes an N-terminal 10xHis-tag and a C-terminal Myc-tag that help with purification and detection. SDS-PAGE analysis confirms the protein shows purity levels greater than 85%, making it suitable for various research applications.

The nucleoprotein (N) of Human coronavirus OC43 plays a crucial role in the virus's life cycle. It's primarily involved in viral RNA encapsidation and appears essential for nucleocapsid assembly and stability. This protein also seems to act as a key regulator of viral replication and transcription. Understanding how this protein works may be vital for research into coronavirus biology and potential therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in a mammalian system, which supports native-like eukaryotic folding and post-translational modifications (PTMs)—critical for the full-length HCoV-OC43 nucleoprotein (N) to interact with viral RNA and host factors. The N-terminal 10xHis and C-terminal Myc tags are minimally disruptive to structure, and full-length expression preserves all potential functional domains. However, no direct validation of folding (e.g., circular dichroism for secondary structure, thermal shift assays for stability) or bioactivity (e.g., RNA binding affinity, oligomerization, or host protein interactions) is provided. While mammalian expression strongly suggests correct folding, bioactivity remains unconfirmed—this limits definitive claims about its native functionality.

1. Antibody Development and Validation

This full-length recombinant HCoV-OC43 N protein can serve as an immunogen for generating monoclonal/polyclonal antibodies, and the dual tags simplify purification/detection. However, antibody specificity must be validated against native N—mammalian expression preserves conformational epitopes, but tag presentation may alter antigenicity, leading to cross-reactivity with non-native targets. ELISA can screen for affinity, but validation with native protein or infected cells is critical.

2. Protein-Protein Interaction Studies

Pull-down assays using the His/Myc tags can identify host interactors, but results depend on correct folding—mammalian expression improves native folding, but interactions must be validated via co-IP or functional assays to rule out artifacts from misfolding. The full length preserves all potential domains, but bioactivity (e.g., RNA binding) is unconfirmed.

3. Biochemical Characterization and Structural Studies

This protein supports biochemical assays (e.g., thermal stability, oligomerization) and structural studies (e.g., crystallography, cryo-EM). Mammalian expression ensures native-like structure, but the C-terminal Myc tag may interfere with crystallization—tag cleavage (via protease) may improve resolution. RNA binding and nucleocapsid assembly must be validated experimentally.

4. Immunoassay Development and Optimization

The dual-tagged N protein is a useful immunoassay standard, but its native conformation must be confirmed—the tags enable consistent detection, but assay performance (sensitivity/specificity) may differ if the protein misfolds. Validate with native N or clinical samples to ensure relevance to HCoV-OC43 biology.

5. Comparative Coronavirus Research

This mammalian-expressed N protein enables cross-reactivity studies with other coronavirus N proteins, as standardized folding reduces variability. However, PTMs may differ slightly between species—results should be contextualized, and direct comparisons (e.g., antibody cross-reactivity) must account for evolutionary divergence.

Final Recommendation & Action Plan

This mammalian-expressed, full-length HCoV-OC43 N protein is a strong candidate for antibody development, immunoassays, and comparative research due to its native-like folding. Prioritize validation of folding (CD/thermal shift) and bioactivity (RNA binding/oligomerization) to ensure reliability. For interactions or structural studies, use tag cleavage if needed and pair with co-IP/functional assays. If validation passes, leverage its consistency for downstream applications—always include native N controls to contextualize results. If folding/bioactivity fails, optimize expression (e.g., co-express chaperones) or use a viral replication system to produce native protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Betacoronavirus nucleocapsid protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*