Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

In Stock
Code CSB-MP822153AIAH
Abbreviation Recombinant Avian infectious bronchitis virus N protein
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein;NC;Protein N
Species
Avian infectious bronchitis virus (strain V18/91) (IBV)
Source
Mammalian cell
Expression Region
1-409aa
Target Protein Sequence
MSAGKLKFDSPAPILKLSKNTGSTPPKVGGTGQASWFQSLKEKKRTGTPPTFEGSGVPDNSNVKPQFQHGYWKRQHRYKPGKGGRKPVADAWYFYYTGTGPFGDLKWGDSNDDVVWVKAKGADTSKIGNYGVRDPDKFDQAPLRFTEGGPDNNYRWDFIALNRGRSRNSSAVTSRENSRPGSRDSSRGRQRSRVDDDLIDRAAKIIMQQQKNGSRISKQKANEMAERKYHKRAIAPGKRIDEVFGQRRKGQAPNFGDDKMIEEGVKDGRLTAMLNLVPTPHACLLGSMVTAKLQPDGLHVRFSFETVVKREDPQFANYSKICDECVDGVGTRPKDDPTPRSRAASKDRNSAPATPKQQRAKKVHKKKEEESSLTEEEEEVNKQLEYDDDVTDIPNKIDWGEGAFDDINI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant avian infectious bronchitis virus nucleoprotein (N) is expressed in a mammalian cell system, which appears to help with proper protein folding and post-translational modifications. The complete protein covers amino acids 1 to 409 and comes with a C-terminal 6xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms purity levels above 90%, suggesting this product works well for research applications that need high-quality proteins.

The nucleoprotein (N) of avian infectious bronchitis virus seems to play a key role in the viral life cycle. It's mainly involved in packaging and encapsidating viral RNA. This protein is likely essential for forming the viral ribonucleoprotein complex, which makes it an interesting target for studies on viral assembly and replication. Learning how this protein functions and interacts with other components may help researchers better understand coronavirus biology more broadly.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Avian infectious bronchitis virus nucleoprotein (N) is a viral RNA-binding protein that requires precise folding, oligomerization, and RNA-binding domain formation for its functional activity in viral replication. The mammalian cell expression system provides a eukaryotic environment that supports proper protein folding, post-translational modifications, and complex assembly, significantly increasing the probability of correct folding. The C-terminal 6xHis tag is relatively small and positioned at the terminus, minimizing interference with functional domains. While mammalian expression provides favorable conditions for this viral protein, experimental validation remains essential to confirm structural integrity and RNA-binding activity.

1. Antibody Development and Validation

Antibody development benefits from correct folding but can proceed based on sequence recognition alone. Antibody development relies on antigenic sequence recognition. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native N protein epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, which are valuable for diagnostic applications.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. Viral nucleoprotein interactions with host proteins or other viral components require precise tertiary and quaternary structure. If correctly folded (verified), the protein is suitable for identifying physiological interaction partners in viral replication. If misfolded/unverified, there is a high risk of non-specific binding or interaction failure.

3. Biochemical Characterization and Binding Assays

These studies are essential for determining folding status and functional competence. Functional RNA-binding requires native protein conformation that must be validated.

 If correctly folded and active (verified), characterization provides reliable data on RNA-binding specificity, oligomerization, and kinetic parameters. If misfolded/inactive (unverified), binding assays will yield negative or misleading results.

4. Immunoassay Development and Standardization

This application is well-suited regardless of folding status. Assay development relies on consistent antigen availability and detection specificity rather than functional conformation. If correctly folded (verified), the protein provides authentic antigenic presentation for assay development. If misfolded/unverified, it remains effective as a standardized antigen for detection assays.

Final Recommendation & Action Plan

The mammalian expression system provides favorable eukaryotic folding conditions for this viral nucleoprotein, but experimental validation of structural integrity and RNA-binding activity is essential before reliable use in functional studies. Begin with Application 3 (Biochemical Characterization) to assess folding quality through size-exclusion chromatography (oligomerization state), circular dichroism spectroscopy, and validate RNA-binding activity using electrophoretic mobility shift assays or other RNA-binding techniques. Once correct folding and functional activity are verified, proceed cautiously with Applications 1, 2, and 4 for antibody development, interaction studies, and assay standardization. If misfolding or lack of RNA-binding is detected, limit applications to linear epitope antibody production (Application 1) and immunoassay development (Application 4), avoiding all functional interaction and binding studies. For reliable IBV research, always include appropriate RNA-binding controls and consider the protein's oligomerization state in experimental design.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Gammacoronavirus nucleocapsid protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*