Recombinant Bovine coronavirus Nucleoprotein (N)

In Stock
Code CSB-EP352608BJN
Abbreviation Recombinant Bovine coronavirus N protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein;NC;Protein N
Species
Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Source
E.coli
Expression Region
1-448aa
Target Protein Sequence
MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine coronavirus Nucleoprotein (N) is produced in E.coli and contains the complete expression region spanning amino acids 1-448. The protein features a C-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the nucleoprotein is greater than 90% pure, suggesting it provides a high-quality reagent for research purposes. This product is intended for research use only, not for diagnostic or therapeutic applications.

The nucleoprotein of Bovine coronavirus appears to play a critical role in the virus's life cycle. It's primarily involved in packaging viral RNA and forming the ribonucleoprotein complex. As a key component in viral replication and assembly, it may represent an important target for studies examining viral pathogenesis and host-virus interactions. This protein is likely valuable for research aimed at understanding coronavirus biology and developing antiviral strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bovine coronavirus Nucleoprotein (N) is a viral RNA-binding protein that requires precise folding, oligomerization, and proper domain formation for its functional activity in viral replication. The E. coli expression system is prokaryotic and may not provide the optimal folding environment for this eukaryotic viral protein, potentially lacking necessary chaperones or post-translational modifications. While the C-terminal 6xHis tag may cause minimal interference, the probability of correct folding with full RNA-binding and oligomerization capability requires experimental validation.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development primarily relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating both linear and potential conformational antibodies. The high purity ensures minimal contamination-related cross-reactivity.

2. Protein-Protein Interaction Studies

This application carries a significant risk without proper folding validation. Nucleoprotein interactions with other viral proteins or host factors require precise tertiary and quaternary structure. If misfolded, the protein may exhibit non-specific binding or fail to replicate genuine physiological interactions.

3. Biochemical Characterization and Biophysical Analysis

These studies are essential for determining folding status and quality. Techniques can assess oligomerization state, thermal stability, and structural integrity, providing critical data for validating the protein preparation regardless of functional activity.

4. Comparative Coronavirus Research

This application requires proper folding validation for structural comparisons. While sequence-based comparisons are feasible, functional and structural comparisons would be invalid with a misfolded protein. Cross-reactivity studies may still provide evolutionary insights.

Final Recommendation & Action Plan

The E. coli expression system may not fully support the correct folding of this viral nucleoprotein, necessitating experimental validation before functional applications. Begin with Application 3 (Biochemical Characterization) to assess oligomerization state via size-exclusion chromatography and structural integrity via circular dichroism spectroscopy. Once folding is verified, proceed cautiously with Applications 2 and 4 for interaction studies and comparative research. Application 1 (antibody development) can proceed immediately. If misfolding is detected, limit use to antibody production and basic biophysical characterization. For reliable functional studies, consider eukaryotic expression systems that better support viral protein folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Betacoronavirus nucleocapsid protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*