Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (E484K), partial (Active)

In Stock
Code CSB-MP3324GMY1(M8)h8
Abbreviation Recombinant SARS-CoV-2 S protein (E484K), partial (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 6.597-8.187 ng/ml. Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody (CSB-RA33245D1GMY), the EC50 is 21.54-26.77 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 6.597-8.187 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody (CSB-RA33245D1GMY), the EC50 is 21.54-26.77 ng/ml.
Target Names
S
Uniprot No.
Alternative Names
S; 2; Spike glycoprotein; S glycoprotein; E2; Peplomer protein)
Molecular Characterization
Species
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Source
Mammalian cell
Expression Region
319-541aa(E484K)
Target Protein Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Mol. Weight
54.4 kDa
Protein Length
Partial
Tag Info
C-terminal mFC-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (E484K) is produced using a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. This partial protein spans amino acids 319-541 with an E484K mutation and includes a C-terminal mFc tag that makes detection and purification more straightforward. The product shows over 90% purity as confirmed by SDS-PAGE while maintaining a low endotoxin level of less than 1.0 EU/µg. Functional ELISA assays have validated its biological activity, demonstrating effective binding to human ACE2 and Biotin-S antibodies.

SARS-CoV-2's Spike glycoprotein (S) plays what may be the most crucial role in viral entry into host cells—it mediates both attachment and fusion. It's become a key research target precisely because of how the virus interacts with the host receptor, ACE2. Understanding how the Spike protein binds and how mutations like the E484K variant change things is essential for studying viral transmission and immune response. This work contributes significantly to vaccine and therapeutic development efforts, though the landscape continues to evolve.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. ACE2-Spike Protein Interaction Studies

This recombinant SARS-CoV-2 Spike RBD (E484K) variant—with confirmed binding activity to ACE2 (EC₅₀: 6.597–8.187 ng/ml)—is a validated tool to investigate how the E484K mutation alters binding kinetics/affinity versus wild-type or other variants. The C-terminal mFc tag simplifies immobilization/detection in SPR, BLI, or ELISA. Results can directly contextualize mutation-driven changes in receptor recognition using the established baseline.

2. Neutralizing Antibody Development and Screening

The biologically active E484K RBD—with confirmed binding to anti-Spike antibodies (EC₅₀: 21.54–26.77 ng/ml)—is a robust immunogen for monoclonal antibody generation and a reliable screening antigen for cross-reactive clones. The mFc tag eases purification and immobilization in high-throughput assays. Its activity ensures consistent performance in evaluating antibody efficacy against the E484K variant.

3. Variant-Specific Binding Assay Development

This E484K mutant RBD—with validated functional activity—is ideal for developing diagnostic assays to differentiate immune responses to this variant. Mammalian expression ensures native-like glycosylation, enhancing relevance to viral physiology. Low endotoxin levels and confirmed activity make it suitable for functional ELISA or other immunoassays, supporting reference standard development for variant-specific antibody testing.

4. Structure-Function Relationship Studies

The correctly folded, biologically active E484K RBD—purified to >90% purity—serves as a reliable model to dissect how the E484K mutation impacts folding, stability, and binding. Techniques like DSC, CD spectroscopy, or HDX-MS can compare mutant vs. wild-type RBD, with the mFc tag aiding purification for biophysical analyses. Confirmed activity validates results by ensuring the protein retains native-like structure-function relationships.

5. Competitive Binding and Epitope Mapping Studies

This bioactive E484K RBD—which binds both ACE2 and anti-Spike antibodies—acts as a validated competitor/reference in epitope mapping. It works in competitive ELISA or flow cytometry to identify antibodies retained/lost against the E484K variant. The mFc tag simplifies detection in multi-protein assays, while confirmed activity ensures consistent performance in dissecting mutation-driven epitope changes.

Final Recommendation & Action Plan

This mammalian-expressed, E484K-mutant Spike RBD (319–541 aa) with a C-terminal mFc tag is highly reliable for its intended applications due to its confirmed bioactivity via ELISA—a critical validation milestone. Leverage its consistent performance to study mutation-driven changes in ACE2 binding, screen neutralizing antibodies, or develop variant-specific assays. Always include wild-type RBD as a control to contextualize E484K effects, and use the mFc tag to streamline purification/detection. For structural studies, the tag may require removal (via protease cleavage) for high-resolution data, but its presence does not compromise functional assays. Overall, this protein is a robust tool for variant-focused SARS-CoV-2 research—prioritize comparative studies with wild-type to maximize insight into the E484K mutation’s impact.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein. Binding to host NRP1 and NRP2 via C-terminal polybasic sequence enhances virion entry into host cell. This interaction may explain virus tropism of human olfactory epithelium cells, which express high level of NRP1 and NRP2 but low level of ACE2. The stalk domain of S contains three hinges, giving the head unexpected orientational freedom. Uses human TMPRSS2 for priming in human lung cells which is an essential step for viral entry. Can be alternatively processed by host furin. Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.; May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.
Gene References into Functions
  1. Study presents crystal structure of C-terminal domain of SARS-CoV-2 (SARS-CoV-2-CTD) spike S protein in complex with human ACE2 (hACE2); hACE2-binding mode similar overall to that observed for SARS-CoV. However, details at the binding interface show that key residue substitutions in SARS-CoV-2-CTD slightly strengthen the interaction and lead to higher affinity for receptor binding than SARS-CoV receptor-binding domain. PMID: 32378705
  2. crystal structure of the receptor-binding domain (RBD) of the spike protein of SARS-CoV-2 bound to the cell receptor ACE2 PMID: 32365751
  3. crystal structure of the receptor-binding domain (RBD) of the spike protein of SARS-CoV-2 (engineered to facilitate crystallization) in complex with ACE2 PMID: 32320687
  4. Out of the two isolates from India compared to the isolates from Wuhan, China, one was found to harbor a mutation in its receptor-binding domain (RBD) at position 407 where, arginine was replaced by isoleucine. This mutation has been seen to change the secondary structure of the protein at that region and this can potentially alter receptor binding of the virus. PMID: 32275855
  5. Structural modeling of the SARS-CoV-2 spike glycoprotein show similar receptor utilization between SARS-CoV-2 and SARS-CoV, despite a relatively low amino acid similarity in the receptor binding module. Compared to SARS-CoV and all other coronaviruses in Betacoronavirus lineage B, an extended structural loop containing basic amino acids were identified at the interface of the receptor binding (S1) and fusion (S2) domains. PMID: 32245784
  6. crystal structure of CR3022, a neutralizing antibody from a SARS patient, in complex with the receptor-binding domain of the SARS-CoV-2 spike (S) protein to 3.1 A; study provides insight into how SARS-CoV-2 can be targeted by the humoral immune response and revealed a conserved, but cryptic epitope shared between SARS-CoV-2 and SARS-CoV PMID: 32225176
  7. SARS-CoV and SARS-CoV-2 spike proteins have comparable binding affinities achieved by balancing energetics and dynamics. The SARS-CoV-2-ACE2 complex contains a higher number of contacts, a larger interface area, and decreased interface residue fluctuations relative to the SARS-CoV-ACE2 complex. PMID: 32225175
  8. Interaction interface between cat/dog/pangolin/Chinese hamster ACE2 and SARS-CoV/SARS-CoV-2 S protein was simulated through homology modeling. Authors identified that N82 of ACE2 showed closer contact with receptor-binding domain of S protein than human ACE2. PMID: 32221306
  9. SARS-CoV-2 S glycoprotein harbors a furin cleavage site at the boundary between the S1/S2 subunits, which is processed during biogenesis and sets this virus apart from SARS-CoV and SARS-related CoVs; determined cryo-EM structures of the SARS-CoV-2 S ectodomain trimer. PMID: 32201080
  10. Study demonstrates that SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. PMID: 32155444
  11. The ACE2-B0AT1 complex exists as a dimer of heterodimers. Structural alignment of the RBD-ACE2-B0AT1 ternary complex with the S protein of SARS-CoV-2 suggests that two S protein trimers can simultaneously bind to an ACE2 homodimer. PMID: 32142651
  12. study demonstrated SARS-CoV-2 S protein entry on 293/hACE2 cells is mainly mediated through endocytosis, and PIKfyve, TPC2 and cathepsin L are critical for virus entry; found that SARS-CoV-2 S protein could trigger syncytia in 293/hACE2 cells independent of exogenous protease; there was limited cross-neutralization activity between convalescent sera from SARS and COVID-19 patients PMID: 32132184
  13. study determined a 3.5-angstrom-resolution cryo-electron microscopy structure of the 2019-nCoV S trimer in the prefusion conformation; provided biophysical and structural evidence that the 2019-nCoV S protein binds angiotensin-converting enzyme 2 (ACE2) with higher affinity than does severe acute respiratory syndrome (SARS)-CoV S PMID: 32075877

Show More

Hide All

Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*