Recombinant Bovine coronavirus Nucleoprotein (N)

In Stock
Code CSB-MP321743BJG
Abbreviation Recombinant Bovine coronavirus N protein
MSDS
Size $396
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein;NC;Protein N
Species
Bovine coronavirus (strain F15) (BCoV) (BCV)
Source
Mammalian cell
Expression Region
1-448aa
Target Protein Sequence
MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTRDGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIVSLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine coronavirus Nucleoprotein (N) is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. The protein spans the complete sequence of 1-448 amino acids and includes a C-terminal 6xHis-tag for simplified purification and detection. Purity levels exceed 85% based on SDS-PAGE confirmation, making this product suitable for various research applications that require high-quality recombinant proteins.

The nucleoprotein of Bovine coronavirus likely plays a critical role in packaging and protecting viral RNA. It participates in forming the ribonucleoprotein complex, which appears essential for viral genome replication and transcription. This protein has become a key focus in research aimed at understanding coronavirus replication mechanisms and developing diagnostic tools.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This full-length recombinant bovine coronavirus nucleoprotein can function as an immunogen for generating monoclonal or polyclonal antibodies specific to BCoV N protein. The C-terminal 6xHis tag simplifies purification and immobilization for antibody screening assays. Researchers may apply this protein in ELISA-based antibody characterization studies to determine binding specificity and affinity. The mammalian expression system likely preserves proper protein folding, which might maintain conformational epitopes important for antibody recognition.

2. Protein-Protein Interaction Studies

The nucleoprotein can be applied in pull-down assays to identify cellular or viral proteins that interact with BCoV N protein during infection. Its C-terminal His-tag allows immobilization on nickel-affinity matrices for capturing potential binding partners from cell lysates or viral protein preparations. Co-immunoprecipitation experiments may help validate specific interactions identified through pull-down approaches. These studies could contribute to understanding the molecular mechanisms behind bovine coronavirus replication and pathogenesis.

3. Structural and Biochemical Characterization

This recombinant protein provides material for biophysical studies focused on characterizing the structural properties of bovine coronavirus nucleoprotein. Researchers might perform circular dichroism spectroscopy to analyze secondary structure content and thermal stability. The protein could also be used in analytical ultracentrifugation or dynamic light scattering experiments to examine oligomerization states and protein aggregation behavior. Such biochemical analyses may provide insights into the fundamental properties of this viral nucleoprotein.

4. Comparative Coronavirus Research

The recombinant BCoV nucleoprotein may function as a reference standard in comparative studies examining nucleoproteins across different coronavirus species. Cross-reactivity studies with antibodies raised against other coronavirus nucleoproteins could reveal conserved and variable epitopes. Sequence and structural comparisons using this purified protein alongside nucleoproteins from other coronaviruses might help identify evolutionary relationships and functional domains. This application supports broader coronavirus research initiatives and pandemic preparedness studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Betacoronavirus nucleocapsid protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*