Recombinant Bovine coronavirus Nucleoprotein (N)

In Stock
Code CSB-MP321743BJG
Abbreviation Recombinant Bovine coronavirus N protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein;NC;Protein N
Species
Bovine coronavirus (strain F15) (BCoV) (BCV)
Source
Mammalian cell
Expression Region
1-448aa
Target Protein Sequence
MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTRDGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIVSLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine coronavirus Nucleoprotein (N) is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. The protein spans the complete sequence of 1-448 amino acids and includes a C-terminal 6xHis-tag for simplified purification and detection. Purity levels exceed 85% based on SDS-PAGE confirmation, making this product suitable for various research applications that require high-quality recombinant proteins.

The nucleoprotein of Bovine coronavirus likely plays a critical role in packaging and protecting viral RNA. It participates in forming the ribonucleoprotein complex, which appears essential for viral genome replication and transcription. This protein has become a key focus in research aimed at understanding coronavirus replication mechanisms and developing diagnostic tools.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in a mammalian cell system, which supports native-like folding and post-translational modifications (PTMs)—critical for the full-length bovine coronavirus nucleoprotein (N) to bind viral RNA and form nucleocapsids. Full-length expression (1–448 aa) preserves all functional domains, and the C-terminal 6xHis tag is minimally disruptive to structure. However, no direct evidence confirms native secondary/tertiary structure (e.g., circular dichroism for RNA-binding pocket geometry, thermal shift assays for stability) or retention of functional conformations. Mammalian expression improves folding likelihood but does not guarantee it. The protein's biological activity (e.g., RNA binding affinity, oligomerization, interaction with viral RNA-dependent RNA polymerase [RdRp]) is untested—while folding is probable, functional validation is required to confirm native-like behavior.

1. Antibody Development and Validation Studies

This full-length recombinant BCoV N protein can serve as an immunogen for generating monoclonal/polyclonal antibodies, and mammalian folding likely preserves conformational epitopes. However, antibody specificity must be validated against native N—the His tag may alter antigenicity, and antibodies may not recognize the fragment in its native context (e.g., on viral particles or infected cells). ELISA can screen for affinity, but validation with native protein or infected cells is critical.

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify cellular/viral interactors, but results depend on correct folding—misfolded N may yield false positives/negatives. Identified partners (e.g., RdRp or host factors) must be validated via co-IP or functional assays (e.g., replicon assays) to rule out artifacts. The full length supports domain-specific interaction mapping, but bioactivity (e.g., RNA binding) is unconfirmed.

3. Structural and Biochemical Characterization

This protein supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) and biochemical assays (e.g., thermal shift for stability). Mammalian expression suggests native-like folding, but the His tag may interfere with high-resolution techniques (e.g., crystallography)—tag cleavage (via protease) may improve results. RNA binding and nucleocapsid assembly must be validated experimentally.

4. Comparative Coronavirus Research

This mammalian-expressed N protein enables cross-species comparisons, but PTM differences (e.g., glycosylation) or folding variations may confound results—BCoV N may behave differently than N from SARS-CoV-2 or MERS-CoV. Evolutionary insights require complementary sequence/functional data to account for system biases.

Final Recommendation & Action Plan

This mammalian-expressed BCoV N protein is a strong candidate for antibody development and functional studies due to its native-like folding potential, but rigorous validation is essential first, confirm folding via circular dichroism/thermal shift assays to rule out misfolding; second, validate bioactivity (e.g., RNA binding, oligomerization) using co-IP or replicon assays; third, for comparative research, pair with full-length proteins from other coronaviruses to contextualize fragment results. Optimize expression (e.g., use glycoengineered cell lines) to enhance native-like PTMs. If folding/bioactivity fails, use a viral replication system to produce native protein—this N protein’s utility for mechanistic studies depends on validating its structural and functional integrity relative to the native virus.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Betacoronavirus nucleocapsid protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*