Recombinant Bovine coronavirus Protein I (N)

In Stock
Code CSB-EP868731BJI
Abbreviation Recombinant Bovine coronavirus protein I (N) protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
Accessory protein N2;N internal ORF protein;IORF;Protein in nucleocapsid ORF
Species
Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)
Source
E.coli
Expression Region
1-207aa
Target Protein Sequence
MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQQGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLHLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Bovine coronavirus Protein I (N) is expressed in E. coli and includes the full-length sequence from amino acids 1 to 207. The protein carries a C-terminal 6xHis-tag, which helps with purification and detection. SDS-PAGE analysis shows the protein reaches a purity level greater than 85%, making it suitable for various research applications. This product is for research use only—not for diagnostic or therapeutic purposes.

Protein I (N) of Bovine coronavirus (BCoV) appears to play a central role in the viral life cycle. The protein is primarily involved in viral replication and assembly processes. As the nucleocapsid protein, it's essential for packaging the viral RNA genome and likely contributes to maintaining the virus's structural integrity. Studying this protein may be crucial for understanding coronavirus biology and could help in developing antiviral strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation

This recombinant bovine coronavirus nucleocapsid protein can work as an immunogen for creating polyclonal or monoclonal antibodies specific to BCoV. The C-terminal 6xHis tag makes purification and immobilization easier for antibody screening assays. Since the full-length expression region (1-207aa) is present, antibodies produced should recognize native epitopes found in the complete nucleocapsid protein. These antibodies might prove valuable as research tools for studying BCoV infection mechanisms and tracking viral protein localization.

2. Protein-Protein Interaction Studies

The His-tagged nucleocapsid protein works well in pull-down assays to identify host cell proteins that interact with the BCoV nucleocapsid during infection. The 6xHis tag allows efficient immobilization on nickel-based affinity matrices for capturing potential binding partners from cell lysates. Studies like these could reveal cellular pathways involved in viral replication, assembly, or how host cells respond to BCoV infection.

3. ELISA-Based Detection Assays

The recombinant protein can function as a coating antigen or standard in enzyme-linked immunosorbent assays for research applications. The His tag allows for oriented immobilization on nickel-coated plates, which may improve assay consistency. Researchers could use this protein to develop assays for measuring anti-BCoV antibody responses in experimental animal studies or for quantifying viral protein levels in infected cell culture systems.

4. Structural and Biochemical Characterization

The purified nucleocapsid protein can undergo biophysical analyses to examine its structural properties. These might include circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation. The high purity (>85%) and His tag make these analyses more straightforward by allowing consistent protein preparation and concentration determination. Such studies could provide insights into the protein's folding, oligomerization state, and stability under different buffer conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host.
Subcellular Location
Virion.
Protein Families
Coronavirus I protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*