Recombinant Bovine coronavirus Protein I (N)

In Stock
Code CSB-EP868731BJI
Abbreviation Recombinant Bovine coronavirus protein I (N) protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
others
Alternative Names
Accessory protein N2;N internal ORF protein;IORF;Protein in nucleocapsid ORF
Species
Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)
Source
E.coli
Expression Region
1-207aa
Target Protein Sequence
MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQQGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLHLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Bovine coronavirus Protein I (N) is expressed in E. coli and includes the full-length sequence from amino acids 1 to 207. The protein carries a C-terminal 6xHis-tag, which helps with purification and detection. SDS-PAGE analysis shows the protein reaches a purity level greater than 85%, making it suitable for various research applications. This product is for research use only—not for diagnostic or therapeutic purposes.

Protein I (N) of Bovine coronavirus (BCoV) appears to play a central role in the viral life cycle. The protein is primarily involved in viral replication and assembly processes. As the nucleocapsid protein, it's essential for packaging the viral RNA genome and likely contributes to maintaining the virus's structural integrity. Studying this protein may be crucial for understanding coronavirus biology and could help in developing antiviral strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in E. coli, a prokaryotic system that lacks eukaryotic post-translational modifications and often fails to produce correctly folded viral nucleocapsid proteins, which typically require specific disulfide bond formation and proper tertiary structure for RNA-binding activity. While the C-terminal 6xHis tag may improve solubility, there is no evidence of proper folding (e.g., via circular dichroism spectroscopy or thermal shift assays) or bioactivity validation (e.g., RNA-binding assays). The protein may be partially or completely misfolded, significantly limiting its ability to mimic native nucleocapsid protein function.

1. Antibody Development and Validation

This recombinant nucleocapsid protein can serve as an immunogen for antibody production, but resulting antibodies must be validated against native BCoV nucleocapsid protein - E. coli-expressed protein may present non-native epitopes, potentially generating antibodies with poor recognition of the properly folded viral protein in infected cells. While the His tag facilitates purification, antibody specificity should be confirmed using natively folded protein standards.

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify potential binding partners, but results are highly dependent on correct protein folding - misfolded nucleocapsid protein may yield non-specific interactions or miss genuine binding partners. Any identified interactors require validation through co-immunoprecipitation experiments with native protein from infected cells to confirm biological relevance.

3. ELISA-Based Detection Assays

This protein can be used in research ELISA formats, but quantitative accuracy depends on proper folding - misfolding may affect antigen-antibody recognition patterns. While suitable for initial assay development, results should be verified using native protein standards, particularly for quantitative measurements of antibody responses or viral protein levels.

4. Structural and Biochemical Characterization

The protein is suitable for preliminary biophysical analysis (circular dichroism, dynamic light scattering, etc.), but results may not reflect native protein properties. These studies can assess basic stability parameters but cannot validate native conformation without comparison to properly folded reference standards. The His tag may also influence oligomerization studies and should be considered when interpreting results.

Final Recommendation & Action Plan

This E. coli-expressed BCoV nucleocapsid protein requires rigorous validation before reliable biological applications. First, confirm structural integrity through circular dichroism spectroscopy and thermal shift assays to assess folding quality. Second, validate functionality using RNA-binding assays or comparison with an eukaryotic-expressed protein. For antibody development, test resulting antibodies against native nucleocapsid protein; for interaction studies, confirm findings with orthogonal methods. If the protein shows evidence of misfolding, consider alternative expression systems (baculovirus, mammalian cells) or include refolding procedures. Always include appropriate controls using natively folded protein when possible to ensure biological relevance of findings.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host.
Subcellular Location
Virion.
Protein Families
Coronavirus I protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*