Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

In Stock
Code CSB-EP608711HIW
Abbreviation Recombinant Human coronavirus HKU1 Non-structural protein 4
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
4
Uniprot No.
Research Area
others
Alternative Names
Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein
Species
Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
Source
E.coli
Expression Region
1-109aa
Target Protein Sequence
MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus HKU1 Non-structural protein 4 is produced in E.coli and includes a full-length amino acid sequence from position 1 to 109. This protein features an N-terminal 6xHis tag for easy purification and detection. It has a purity exceeding 85%, as verified by SDS-PAGE analysis. This product is designed for research use only and is not intended for diagnostic or therapeutic applications.

Non-structural protein 4 (nsp4) of Human coronavirus HKU1 appears to play a crucial role in the virus's replication and assembly processes. It seems to be involved in forming the replication organelle, which is essential for viral genome replication. Research into nsp4 may provide valuable insights into coronavirus biology and potentially help in developing strategies to combat viral infections.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in E. coli as a full-length non-structural protein 4 (NSP4) of HCoV-HKU1 (1–109 aa) with an N-terminal 6xHis tag. While full-length expression preserves the complete primary sequence, E. coli often struggles to correctly fold coronavirus non-structural proteins—many of which rely on precise disulfide bonds, transmembrane domains, or interaction interfaces for function. No data confirms native secondary/tertiary structure (e.g., circular dichroism, thermal shift assays) or stability. E. coli may produce misfolded NSP4, which fails to adopt the conformation required for biological activity. NSP4 is critical for viral replication (e.g., forming the replication-transcription complex with other NSPs). Its bioactivity (e.g., binding to NSP12/NSP7 or host factors) is untested—E. coli-expressed protein may lack functional interfaces, limiting its ability to mimic native NSP4.

1. Viral Protein Interaction Studies

This recombinant NSP4 can be used in pull-down/co-IP assays to map interactions, but results depend entirely on correct folding—E. coli-expressed NSP4 may misfold, causing false positives/negatives. Identified partners must be validated via functional assays (e.g., replicon assays) to rule out artifacts. The full length supports interaction studies, but bioactivity (e.g., binding to other NSPs) is unconfirmed.

2. Antibody Development and Characterization

This protein can serve as an immunogen, but antibody specificity must be validated against native NSP4—E. coli-expressed protein may present non-native epitopes, leading to antibodies that fail to recognize native NSP4 in viral particles or infected cells. The His tag simplifies ELISA screening, but antibody utility for detecting infection or localizing NSP4 requires validation with native samples.

3. Structural and Biochemical Characterization

This NSP4 supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) but cannot inform native NSP4 architecture—E. coli-expressed protein may lack correct disulfide bonds or oligomerization states. Structural conclusions (e.g., monomeric vs. multimeric) must be contextualized by folding limitations.

4. Comparative Coronavirus Research

This protein enables cross-reactivity studies with other coronavirus NSP4 orthologs, but PTMs and folding differences may confound results—E. coli-expressed HCoV-HKU1 NSP4 may not align structurally with NSP4 from SARS-CoV/MERS-CoV. Evolutionary insights require complementary data (e.g., sequence alignment, functional assays) to account for system-specific artifacts.

Final Recommendation & Action Plan

This E. coli-expressed HCoV-HKU1 NSP4 has potential for interaction mapping or antibody development but requires urgent validation first, confirm folding via circular dichroism/thermal shift assays; second, validate bioactivity (e.g., binding to NSP12) using co-IP or replicon assays. Optimize expression (e.g., co-express molecular chaperones like GroEL/ES, lower induction temperature) to improve solubility/native folding. For comparative research, use orthogonal methods (e.g., NMR for structural alignment) to mitigate system biases. If folding/bioactivity fails, switch to a eukaryotic system (e.g., insect cells) or in vitro refolding to ensure native structure—this NSP4’s role in replication demands functional validation before downstream use.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*