Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

In Stock
Code CSB-EP608711HIW
Abbreviation Recombinant Human coronavirus HKU1 Non-structural protein 4
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
4
Uniprot No.
Research Area
others
Alternative Names
Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein
Species
Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
Source
E.coli
Expression Region
1-109aa
Target Protein Sequence
MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus HKU1 Non-structural protein 4 is produced in E.coli and includes a full-length amino acid sequence from position 1 to 109. This protein features an N-terminal 6xHis tag for easy purification and detection. It has a purity exceeding 85%, as verified by SDS-PAGE analysis. This product is designed for research use only and is not intended for diagnostic or therapeutic applications.

Non-structural protein 4 (nsp4) of Human coronavirus HKU1 appears to play a crucial role in the virus's replication and assembly processes. It seems to be involved in forming the replication organelle, which is essential for viral genome replication. Research into nsp4 may provide valuable insights into coronavirus biology and potentially help in developing strategies to combat viral infections.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Viral Protein Interaction Studies

This recombinant HCoV-HKU1 non-structural protein 4 can be used to investigate protein-protein interactions within the viral replication complex or with host cell proteins. The N-terminal 6xHis tag makes pull-down assays and co-immunoprecipitation experiments possible to identify binding partners. Studies like these could provide insights into the molecular mechanisms of HCoV-HKU1 replication and pathogenesis. The purified protein works as a defined reagent for systematic interaction mapping experiments.

2. Antibody Development and Characterization

The recombinant protein can serve as an immunogen for generating polyclonal or monoclonal antibodies specific to HCoV-HKU1 non-structural protein 4. Its high purity (>85%) makes it suitable for immunization protocols and subsequent antibody screening assays. These antibodies could become valuable research tools for detecting viral infection, studying protein localization, or developing research-grade detection methods. The His-tagged protein also makes ELISA-based antibody characterization and titration studies more straightforward.

3. Structural and Biochemical Characterization

This purified recombinant protein provides material for biophysical and structural studies of HCoV-HKU1 non-structural protein 4. Researchers might use techniques such as circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to characterize the protein's folding, stability, and oligomerization state. The defined expression region (1-109aa) represents the complete protein sequence, making it suitable for comprehensive structural analysis. Studies of this nature could contribute to understanding the molecular basis of coronavirus non-structural protein function.

4. Comparative Coronavirus Research

The recombinant protein allows for comparative studies between HCoV-HKU1 and other coronavirus non-structural proteins to identify conserved or divergent functional domains. Cross-reactivity studies with antibodies raised against other coronavirus proteins could reveal evolutionary relationships and antigenic similarities. Researchers can use the protein in parallel assays with corresponding proteins from SARS-CoV, MERS-CoV, or other coronaviruses to understand species-specific differences. This comparative approach may provide insights into coronavirus evolution and host adaptation mechanisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*