Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial

In Stock Promotion
Code CSB-EP618924HIV
Abbreviation Recombinant Human coronavirus HKU1 S protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
S
Uniprot No.
Research Area
Microbiology
Alternative Names
S glycoprotein;E2;Peplomer protein
Species
Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Source
E.coli
Expression Region
310-622aa
Target Protein Sequence
TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPSVVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCSCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEVSTGVCVNY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus HKU1 Spike glycoprotein (S) is produced in E. coli and consists of a partial length from amino acids 310 to 622. The protein includes a C-terminal 6xHis-tag for ease of purification and detection. Purity reaches greater than 90% as determined by SDS-PAGE, which appears to make it suitable for various research applications. This product is intended for research use only, with no endotoxin level specified.

The Spike glycoprotein (S) of Human coronavirus HKU1 seems integral to the virus's ability to attach and enter host cells. It likely plays a crucial role in viral entry through interactions with host cell receptors, making it a key focus in studies of viral infection mechanisms and immune response. Understanding its structure and function may be essential for developing therapeutic strategies and vaccines against coronaviruses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

While the His tag improves solubility, E. coli struggles to correctly fold eukaryotic membrane proteins like the S protein. No data confirms native secondary/tertiary structure (e.g., circular dichroism for disulfide bonds, thermal shift assays for stability). E. coli may misfold the fragment, leading to aggregation or non-functional conformations. The fragment lacks full-length S context (e.g., receptor-binding domain [RBD], fusion machinery), so it cannot recapitulate native interactions (e.g., with host receptors like CEACAM5 for HKU1). Bioactivity (e.g., ligand binding, oligomerization) is untested and unlikely to mirror wild-type S.

1. Antigen for Antibody Development and Characterization

This recombinant S fragment (310–622 aa) can serve as an antigen for generating antibodies, but antibody specificity must be validated against native S—E. coli-expressed protein may present non-native epitopes, leading to cross-reactivity with irrelevant targets. The His tag streamlines purification/immobilization for immunization, but antibodies may not recognize the fragment in its native context (e.g., on viral particles). High purity supports consistent immunogenicity, but validation with native protein is critical.

2. Protein-Protein Interaction Studies

Pull-down assays using the His tag can identify interactors, but results depend on correct folding—E. coli-expressed fragments often misfold, causing false positives/negatives. Identified partners (e.g., host receptors or viral NSPs) must be validated via co-IP or functional assays (e.g., replicon assays) to rule out artifacts. The partial length restricts insights to interactions within this domain, not full-length S biology.

3. Structural and Biochemical Characterization

This fragment supports preliminary biophysical studies (e.g., circular dichroism for secondary structure, dynamic light scattering for stability) but cannot inform native S architecture—E. coli-expressed protein may lack correct disulfide bonds or domain folding. Structural conclusions (e.g., oligomerization) must be contextualized by folding limitations.

4. ELISA-Based Binding and Competition Assays

Immobilization of the His-tagged protein enables quantitative binding studies, but misfolding may alter binding kinetics—results are qualitative at best. Quantitative affinity measurements require a confirmed native structure, as the fragment’s conformation may not support native-like interactions. High purity ensures consistent coating, but validation with native S is needed for assay relevance.

Final Recommendation & Action Plan

This E. coli-expressed HCoV-HKU1 S fragment has potential for antibody development or preliminary interaction studies, but requires rigorous validation first, confirm folding via circular dichroism/thermal shift assays to rule out misfolding; second, test bioactivity (e.g., binding to known ligands or host receptors) using co-IP or cell-based assays. Optimize expression (e.g., co-express chaperones like GroEL/ES, lower induction temperature) to improve solubility/native folding. For antibody development, validate specificity against native S; for interactions/ELISA, use tag cleavage or orthogonal methods (e.g., surface plasmon resonance) to reduce artifacts. If folding/bioactivity fails, switch to a eukaryotic system (e.g., mammalian/insect cells) to ensure native structure—this fragment’s utility for functional studies depends on validating its structural and functional integrity relative to the full-length S protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.
Protein Families
Betacoronaviruses spike protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*