Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

In Stock
Code CSB-EP018353EEB1
Abbreviation Recombinant Escherichia phage T7 T7 RNA polymerase protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
1
Uniprot No.
Research Area
Signal Transduction
Species
Escherichia phage T7 (Bacteriophage T7)
Source
E.coli
Expression Region
710-805aa
Target Protein Sequence
VKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Highly processive DNA-dependent RNA polymerase that catalyzes the transcription of class II and class III viral genes. Recognizes a specific promoter sequence and enters first into an 'abortive phase' where very short transcripts are synthesized and released before proceeding to the processive transcription of long RNA chains. Unwinds the double-stranded DNA to expose the coding strand for templating. Participates in the initiation of viral DNA replication presumably by making primers accessible to the DNA polymerase, thus facilitating the DNA opening. Plays also a role in viral DNA packaging, probably by pausing the transcription at the right end of concatemer junction to allow packaging complex recruitment and beginning of the packaging process.
Gene References into Functions
  1. Using correlation analysis, it was found that the promoter strength characterized by reporter gene expression was closely correlated with rupture force and the binding percentage of T7 RNA polymerase by force spectroscopy. PMID: 29187520
  2. From the docking of the minimum energy representative structures of T7 lysozyme at different pH strengths (obtained from the free energy landscape analysis) with T7RNAP structures at same pH strengths, we saw strong interaction patterns at pH 7.9 and pH 5. PMID: 28545576
  3. Data suggest that comparative transcriptional fidelities/mutation rates for DNA-directed RNA polymerases are as follows: human mitochondrial POLRMT [2x10(-5)]; Saccharomyces cerevisiae mitochondrial Rpo41 [6x10(-6)]; phage T7 single-subunit RNA polymerase [2x10(-6)]. PMID: 28882896
  4. Molecular dynamics simulation study described the behavior of the two magnesium ions in RNAP activity during genetic transcription. PMID: 28205291
  5. The control of the discrimination between dNTP and rNTP in DNA and RNA polymerases has been described. PMID: 27480935
  6. The study provides evidence that the intrinsic infidelity of T7 RNAP in transcription brings significant phenotypic consequences, observed as frameshift mutation restoration and the production of a heterogenous population of the full-length protein. PMID: 25824942
  7. We show here that DNA-protein cross-links constitute strong but not absolute blocks to in vitro transcription catalyzed by T7 RNAP. PMID: 22235136
  8. Hydrogen bonds of RNA polymerase play an important role in the efficiency of transcription. PMID: 22044042
  9. introducing a nuclear transgene, ST7, encoding a light-regulated plastid-targeted T7RNAP by cross-pollination. PMID: 15517992
  10. T7 promoter-polymerase interaction weakening facilitates promoter release PMID: 15711016
  11. An amino acid substitution weakens promoter binding but markedly reduces abortive cycling over a variety of initial sequences. PMID: 15831591
  12. structure activity relationship PMID: 16301518
  13. Active T7RNAP elongation by showing that both rapidly elongating and halted complexes are equally sensitive to pyrophosphate. PMID: 16516229
  14. Collapse of the DNA from the downstream end of the bubble is a major contributor to the characteristic instability of the abortive T7 RNA polymerase transcription complex. PMID: 16790422
  15. Poto-regulation of transcription reaction by azobenzene-tethered promoter was attributed to the change of binding property of RNAP to the promoter by trans-cis isomerization of azobenzene. PMID: 17150558
  16. transition to an elongation complex by T7 RNA polymerase is a multistep process PMID: 17548349
  17. site-specifically tethered chemical nucleases and functional characterization of directed T7 RNAP mutants to both reveal the architecture of the duplex DNA PMID: 17580086
  18. G-rich sequences located in the transcribed strand do not affect transcription by either polymerase, but when the sequences are located in the non-transcribed strand, they partially arrest both polymerases PMID: 18292094
  19. study reports crystal structures of T7 RNAP bound to promoter DNA containing either a 7- or an 8-nucleotide (nt) RNA transcript that illuminate intermediate states along the transition pathway PMID: 18948533

Show More

Hide All

Protein Families
Phage and mitochondrial RNA polymerase family
Database Links

KEGG: vg:1261050

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*