Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Uniprot No.

P00573

Research Area

Signal Transduction

Species

Escherichia phage T7 (Bacteriophage T7)

Source

E.coli

Expression Region

710-805aa

Target Protein Sequence

VKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

26.5 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-KSI-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Highly processive DNA-dependent RNA polymerase that catalyzes the transcription of class II and class III viral genes. Recognizes a specific promoter sequence and enters first into an 'abortive phase' where very short transcripts are synthesized and released before proceeding to the processive transcription of long RNA chains. Unwinds the double-stranded DNA to expose the coding strand for templating. Participates in the initiation of viral DNA replication presumably by making primers accessible to the DNA polymerase, thus facilitating the DNA opening. Plays also a role in viral DNA packaging, probably by pausing the transcription at the right end of concatemer junction to allow packaging complex recruitment and beginning of the packaging process.

Gene References into Functions

Using correlation analysis, it was found that the promoter strength characterized by reporter gene expression was closely correlated with rupture force and the binding percentage of T7 RNA polymerase by force spectroscopy. PMID: 29187520
From the docking of the minimum energy representative structures of T7 lysozyme at different pH strengths (obtained from the free energy landscape analysis) with T7RNAP structures at same pH strengths, we saw strong interaction patterns at pH 7.9 and pH 5. PMID: 28545576
Data suggest that comparative transcriptional fidelities/mutation rates for DNA-directed RNA polymerases are as follows: human mitochondrial POLRMT [2x10(-5)]; Saccharomyces cerevisiae mitochondrial Rpo41 [6x10(-6)]; phage T7 single-subunit RNA polymerase [2x10(-6)]. PMID: 28882896
Molecular dynamics simulation study described the behavior of the two magnesium ions in RNAP activity during genetic transcription. PMID: 28205291
The control of the discrimination between dNTP and rNTP in DNA and RNA polymerases has been described. PMID: 27480935
The study provides evidence that the intrinsic infidelity of T7 RNAP in transcription brings significant phenotypic consequences, observed as frameshift mutation restoration and the production of a heterogenous population of the full-length protein. PMID: 25824942
We show here that DNA-protein cross-links constitute strong but not absolute blocks to in vitro transcription catalyzed by T7 RNAP. PMID: 22235136
Hydrogen bonds of RNA polymerase play an important role in the efficiency of transcription. PMID: 22044042
introducing a nuclear transgene, ST7, encoding a light-regulated plastid-targeted T7RNAP by cross-pollination. PMID: 15517992
T7 promoter-polymerase interaction weakening facilitates promoter release PMID: 15711016
An amino acid substitution weakens promoter binding but markedly reduces abortive cycling over a variety of initial sequences. PMID: 15831591
structure activity relationship PMID: 16301518
Active T7RNAP elongation by showing that both rapidly elongating and halted complexes are equally sensitive to pyrophosphate. PMID: 16516229
Collapse of the DNA from the downstream end of the bubble is a major contributor to the characteristic instability of the abortive T7 RNA polymerase transcription complex. PMID: 16790422
Poto-regulation of transcription reaction by azobenzene-tethered promoter was attributed to the change of binding property of RNAP to the promoter by trans-cis isomerization of azobenzene. PMID: 17150558
transition to an elongation complex by T7 RNA polymerase is a multistep process PMID: 17548349
site-specifically tethered chemical nucleases and functional characterization of directed T7 RNAP mutants to both reveal the architecture of the duplex DNA PMID: 17580086
G-rich sequences located in the transcribed strand do not affect transcription by either polymerase, but when the sequences are located in the non-transcribed strand, they partially arrest both polymerases PMID: 18292094
study reports crystal structures of T7 RNAP bound to promoter DNA containing either a 7- or an 8-nucleotide (nt) RNA transcript that illuminate intermediate states along the transition pathway PMID: 18948533

Hide All

Protein Families

Phage and mitochondrial RNA polymerase family

Database Links

KEGG: vg:1261050

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP018353EEB1
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage