Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P17401

Research Area

Microbiology

Alternative Names

X; Protein X; HBx; Peptide X; pX

Species

Woodchuck hepatitis B virus (isolate 8) (WHV)

Source

E.coli

Expression Region

1-141aa

Target Protein Sequence

MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.2kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process of expressing the recombinant Woodchuck hepatitis B virus Protein X (X) protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 1-141aa of the Woodchuck hepatitis B virus Protein X (X) protein and N-terminal 6xHis tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-tagged recombinant Protein X (X) protein was obtained. This recombinant Protein X (X) protein is characterized by high purity (>90%, SDS-PAGE). This Protein X (X) protein ran along the gel to the band of approximately 21 kDa molecular weight.

Protein X (also known as peptide X) is a protein encoding by a gene named X in Woodchuck hepatitis B virus. Protein X has no counterparts in any of its hosts and is conserved among mammalian hepadnavirus. This protein is well known for its transactivation activity through interaction with several cellular transcription factors, In addition to its role in viral replication and chromosomal instability, it is also known as an oncogene involving in modulating oncogenic pathways, oxidative stress, DNA methylation, angiogenesis and migration.

Target Background

Function

Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC). Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT.

Subcellular Location

Host cytoplasm. Host nucleus. Host mitochondrion.

Protein Families

Orthohepadnavirus protein X family

Code	CSB-EP323774WAW
Abbreviation	Recombinant Woodchuck hepatitis B virus protein X
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Woodchuck hepatitis B virus Protein X (X)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage