Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
X; Protein X; HBx; Peptide X; pX
Species
Woodchuck hepatitis B virus (isolate 8) (WHV)
Expression Region
1-141aa
Target Protein Sequence
MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The process of expressing the recombinant Woodchuck hepatitis B virus Protein X (X) protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 1-141aa of the Woodchuck hepatitis B virus Protein X (X) protein and N-terminal 6xHis tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-tagged recombinant Protein X (X) protein was obtained. This recombinant Protein X (X) protein is characterized by high purity (>90%, SDS-PAGE). This Protein X (X) protein ran along the gel to the band of approximately 21 kDa molecular weight.
Protein X (also known as peptide X) is a protein encoding by a gene named X in Woodchuck hepatitis B virus. Protein X has no counterparts in any of its hosts and is conserved among mammalian hepadnavirus. This protein is well known for its transactivation activity through interaction with several cellular transcription factors, In addition to its role in viral replication and chromosomal instability, it is also known as an oncogene involving in modulating oncogenic pathways, oxidative stress, DNA methylation, angiogenesis and migration.