Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	AR
Uniprot No.	P10275
Research Area	Signal Transduction
Alternative Names	Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	551-919aa
Target Protein Sequence	DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	62.4kDa
Protein Length	Partial
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

■ Q&A

It says online that the tag is N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged:
1. Why is the SUMO-tagged? SUMO-tag is bad for transcription factors.
2. What SUMO-tag was used? SUMO1, SUMO2, SUMO3 or SUMO4?
3. Can this be made without SUMO? Maybe make with His and Myc Tag?

Very nice to receive your inquiry.
1. The SUMO-tag helps protein folding and helps expression of soluble protein.
2. The sequence of our SUMO-tag is as follows:

MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

The result of the uniprot blasting is https://www.uniprot.org/uniprot/Q12306, which should be SUMO3.
3. We could try to express this protein using other tag without SUMO, for example, N-terminal 10xHis-tagged and C-terminal Myc-tagged.

1. Can we just “chop off” the SUMO with a SUMO-specific protease? Has your group done that?
2. If so, which SUMO protease and is it commercially-available?
3. Ulp1 is the protease to cleave after GG in the yeast SUMO3?

Thanks for your response.
1. The other SUMO-tagged proteins we expressed have been successfully digested with our self-produced SUMO enzyme before.
However, we haven't tried to removed tag from this fusion protein using SUMO enzyme yet. If you have interest, you could have a try.
2. Our self-produced SUMO enzyme is as follows. Code: CSB-EP311619SVG Name: Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1(ULP1) ,partial
We generally use this protein to remove SUMO-tag. LifeSensors has three SUMO enzymes (SUMO protease1, SUMO Protease 2, and SUMOstar Protease from LifeSensors). Our self-produced SUMO enzyme Ulp1, corresponding to SUMO protease1 from the company LifeSensors.
3. Wikipedia shows "Hydrolysis of the alpha-linked peptide bond in the sequence Gly-Gly-!Ala-Thr-Tyr at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptide, Smt3".
Here is the link: https://en.wikipedia.org/wiki/Ulp1_peptidase Therefore, GG is the cleavage site of the SUMO enzyme. We used the expression vector pet 28a-sumo to introduce thrombin cleavage sites, where R is the cleavage site (LVPRGS). The customer could also try thrombin cleavage and resection, but we cannot be 100% sure that it can be removed.
The sequence of the fusion protein with pET28a-sumo-10xhis/myc is as below.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT+ Target Protein + AAAEQKLISEEDL-

■ Customer Reviews

Target Data

Function	Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.
Involvement in disease	Androgen insensitivity syndrome (AIS); Spinal and bulbar muscular atrophy X-linked 1 (SMAX1); Androgen insensitivity, partial (PAIS)
Subcellular Location	Nucleus, Cytoplasm
Protein Families	Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity	Isoform 2 is mainly expressed in heart and skeletal muscle (PubMed:15634333). Isoform 3 is expressed by basal and stromal cells of prostate (at protein level) (PubMed:19244107).
Database Links	HGNC: 644 OMIM: 300068 KEGG: hsa:367 STRING: 9606.ENSP00000363822 UniGene: Hs.76704

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How did you know this promotion?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP001975HU
Size	US$1726Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Recombinant Human Androgen receptor(AR) ,partial

Product Details

Related Products

Q&A and Customer Reviews

Target Data

Most popular with customers

CloseMessage

×CloseMessage