Code | CSB-EP001975HU |
Abbreviation | Recombinant Human AR protein, partial |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
A target DNA sequence encoding to the 551-919aa of human Androgen receptor (AR) was fused with an N-terminal 10xHis-SUMO-tag and a C-terminal Myc-tag and then expressed in the E.coli. The resulting protein is a partial-length recombinant AR protein. It got purified by the SDS-PAGE analysis over 90% in purity. The SDS-PAGE of this AR protein gave a 55-66 kDa band. The in-stock protein allows it to reach your lab bench faster. This recombinant AR protein may be applied to generate specific antibodies and in the AR-related signal transduction research.
AR belonging to the steroid hormone nuclear receptor family is a ligand-dependent nuclear transcription factor. Androgen/AR interaction is involved in a broad of biological functions, such as the expression of the male phenotype and the development & maintenance of the reproductive, musculoskeletal, cardiovascular, immune, neural, and hemopoietic systems. De-regulation of AR is associated with some types of cancers in the prostate, lung, and liver, etc.
There are currently no reviews for this product.
It says online that the tag is N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged:
1. Why is the SUMO-tagged? SUMO-tag is bad for transcription factors.
2. What SUMO-tag was used? SUMO1, SUMO2, SUMO3 or SUMO4?
3. Can this be made without SUMO? Maybe make with His and Myc Tag?
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
1. Can we just “chop off” the SUMO with a SUMO-specific protease? Has your group done that?
2. If so, which SUMO protease and is it commercially-available?
3. Ulp1 is the protease to cleave after GG in the yeast SUMO3?
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT+ Target Protein + AAAEQKLISEEDL-
What is the stability of this protein? Have there been complaints? I've heard that AR-NTD has instability issues.
This protein has been sold many times, with a total of more than 17.5mg, and only one complaint occurred. The reason is that the protein was delayed in transportation, resulting in the degradation of the protein received by the customer. We supplied the customer with the protein again and the customer said that the experiment can be carried out smoothly. Before long, he ordered the protein again.
At present, the stability of the protein is relatively good, and we will conduct quality control before shipment. In addition, we suggest that customers can order small sizes for testing first.