Code | CSB-EP001975HU |
Size |
US$1726Purchase it in Cusabio online store (only available for customers from the US) |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | AR |
Uniprot No. | P10275 |
Research Area | Signal Transduction |
Alternative Names | Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 551-919aa |
Target Protein Sequence | DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 62.4kDa |
Protein Length | Partial |
Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
It says online that the tag is N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged:
1. Why is the SUMO-tagged? SUMO-tag is bad for transcription factors.
2. What SUMO-tag was used? SUMO1, SUMO2, SUMO3 or SUMO4?
3. Can this be made without SUMO? Maybe make with His and Myc Tag?
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
1. Can we just “chop off” the SUMO with a SUMO-specific protease? Has your group done that?
2. If so, which SUMO protease and is it commercially-available?
3. Ulp1 is the protease to cleave after GG in the yeast SUMO3?
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT+ Target Protein + AAAEQKLISEEDL-
Function | Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3. |
Involvement in disease | Androgen insensitivity syndrome (AIS); Spinal and bulbar muscular atrophy X-linked 1 (SMAX1); Androgen insensitivity, partial (PAIS) |
Subcellular Location | Nucleus, Cytoplasm |
Protein Families | Nuclear hormone receptor family, NR3 subfamily |
Tissue Specificity | Isoform 2 is mainly expressed in heart and skeletal muscle (PubMed:15634333). Isoform 3 is expressed by basal and stromal cells of prostate (at protein level) (PubMed:19244107). |
Database Links |
HGNC: 644 OMIM: 300068 KEGG: hsa:367 STRING: 9606.ENSP00000363822 UniGene: Hs.76704 |
Recombinant Salmonella typhimurium D-galactose-binding periplasmic protein(mglB)
Express system: Yeast
Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human UDP-glucuronosyltransferase 1-1(UGT1A1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Proteasome subunit beta type-8(PSMB8)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-lymphocyte activation antigen CD80(CD80)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide