Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	AR
Uniprot No.	P10275
Research Area	Signal Transduction
Alternative Names	AIS; ANDR_HUMAN; Androgen nuclear receptor variant 2; Androgen receptor (dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease); Androgen receptor; androgen receptor splice variant 4b; AR; AR8; DHTR; Dihydro testosterone receptor; Dihydrotestosterone receptor (DHTR); Dihydrotestosterone receptor; HUMARA; HYSP1; KD; Kennedy disease (KD); NR3C4; Nuclear receptor subfamily 3 group C member 4 (NR3C4); Nuclear receptor subfamily 3 group C member 4; SBMA; SMAX1; Spinal and bulbar muscular atrophy (SBMA); Spinal and bulbar muscular atrophy; Testicular Feminization (TFM); TFM
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	551-919aa
Target Protein Sequence	DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	62.4kDa
Protein Length	Partial
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Q&A and Customer Reviews

■ Q&A

It says online that the tag is N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged:
1. Why is the SUMO-tagged? SUMO-tag is bad for transcription factors.
2. What SUMO-tag was used? SUMO1, SUMO2, SUMO3 or SUMO4?
3. Can this be made without SUMO? Maybe make with His and Myc Tag?

Very nice to receive your inquiry.
1. The SUMO-tag helps protein folding and helps expression of soluble protein.
2. The sequence of our SUMO-tag is as follows:

MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

The result of the uniprot blasting is https://www.uniprot.org/uniprot/Q12306, which should be SUMO3.
3. We could try to express this protein using other tag without SUMO, for example, N-terminal 10xHis-tagged and C-terminal Myc-tagged.

1. Can we just “chop off” the SUMO with a SUMO-specific protease? Has your group done that?
2. If so, which SUMO protease and is it commercially-available?
3. Ulp1 is the protease to cleave after GG in the yeast SUMO3?

Thanks for your response.
1. The other SUMO-tagged proteins we expressed have been successfully digested with our self-produced SUMO enzyme before.
However, we haven't tried to removed tag from this fusion protein using SUMO enzyme yet. If you have interest, you could have a try.
2. Our self-produced SUMO enzyme is as follows. Code: CSB-EP311619SVG Name: Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1(ULP1) ,partial
We generally use this protein to remove SUMO-tag. LifeSensors has three SUMO enzymes (SUMO protease1, SUMO Protease 2, and SUMOstar Protease from LifeSensors). Our self-produced SUMO enzyme Ulp1, corresponding to SUMO protease1 from the company LifeSensors.
3. Wikipedia shows "Hydrolysis of the alpha-linked peptide bond in the sequence Gly-Gly-!Ala-Thr-Tyr at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptide, Smt3".
Here is the link: https://en.wikipedia.org/wiki/Ulp1_peptidase Therefore, GG is the cleavage site of the SUMO enzyme. We used the expression vector pet 28a-sumo to introduce thrombin cleavage sites, where R is the cleavage site (LVPRGS). The customer could also try thrombin cleavage and resection, but we cannot be 100% sure that it can be removed.
The sequence of the fusion protein with pET28a-sumo-10xhis/myc is as below.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT+ Target Protein + AAAEQKLISEEDL-

■ Customer Reviews

Target Data

Function	Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.
Gene References into Functions	AR expression heterogeneity is linked to distinct castration/enzalutamide responses in castration-resistant prostate cancer. PMID: 30190514 Androgen receptor positive triple negative breast cancer: Clinicopathologic, prognostic, and predictive features PMID: 29883487 In prostate cancer cells, AR-V7 expression is correlated with drug resistance, as AR-V7 upregulation leads to enhanced proliferation potency of cancer cells, indicating unfavorable prognosis of patients. PMID: 30284554 These findings imply that the deep intronic mutation creating an alternative splice acceptor site resulted in the production of a relatively small amount of wildtype androgen receptor mRNA, leading to partial androgen insensitivity syndrome. PMID: 29396419 AR Germline Mutations and Polymorphisms were associated with Prostate Cancer. PMID: 30139231 GTEE also downregulated the expression of AR and prostate-specific antigen (PSA) in both androgen-responsive and castration-resistant PCa cells. By blocking the SREBP-1/AR axis, GTEE suppressed cell growth and progressive behaviors, as well as activating the caspase-dependent apoptotic pathway in PCa cells PMID: 30301150 Suppressed the expression of androgen receptor. PMID: 29981500 An AR motif of the transactivation domain has been identified that contributes to transcriptional activity by recruiting the C-terminal domain of subunit 1 of the general transcription regulator TFIIF. PMID: 29225078 In LNCaP prostate cancer cells, TSG101 overexpression recruits the androgen receptor (AR) to TSG101-containing cytoplasmic vesicles resulting in reduced AR protein level and AR transactivation activity downregulation. Immunofluorescence microscopy demonstrated that TSG101-decorated cytoplasmic vesicles are associated with late endosomes/lysosomes. PMID: 29859188 Study indicates that both mRNA and protein level of AR increase during prostate cancer (PCa) progression. These levels are even higher in metastatic PCa. Further data suggest that elevation of AR may promote PCa metastasis by induction of EMT and reduction of KAT5. PMID: 30142696 This study aimed to determine the presence and localization of oestrogen receptors (ERs), progesterone receptors (PRs), and androgen receptors (ARs) in both healthy and varicose vein wall cells and their relationship with gender. PMID: 30250632 These findings suggest that CDK11 is involved in the regulation of AR pathway and AR can be a potential novel prognostic marker and therapeutic target for osteosarcoma treatment. PMID: 28262798 We use CPRC prostate cancer model and demonstrate that endothelial cells secrete large amount of CCL5 and induces autophagy by suppressing AR expression in prostate cancer cell lines. Consequently, elevated autophagy accelerates focal adhesions proteins disassembly and promoted prostate cancer invasion. Inhibition of both CCL5/CCR5 signaling and autophagy significantly reduces metastasis in vivo PMID: 30200999 Overexpression of nuclear AR-V7 protein identifies a subset of tumors with remarkably aggressive growth characteristics among clinically and histologically high-risk patients at the time of radical prostatectomy. PMID: 29198908 Study defines AR ligand-binding domain homodimerization as an essential step in the proper functioning of this important transcription factor. Dimerization surface harbours over 40 previously unexplained androgen insensitivity syndromes and prostate cancer-associated point mutations. PMID: 28165461 Loss of AR expression was found in the nucleus of penile cancer cells when compared to normal tissues. Cytoplasmic AR immunostaining was observed in a significant number of these cases and was related with poor prognosis and shorter overall survival. PMID: 30099587 The AR polymorphism is associated with POR risk, patients with repeats greater than 22 show a higher risk. Our data suggest that AR genotype could play a role in natural ovarian aging. PMID: 29886316 In all, these data suggest that Aurora A plays a pivotal role in regulation of Androgen receptor variant 7 expression and represents a new therapeutic target in castrate-resistant prostate cancer. PMID: 28205582 The meta-analysis showed that short CAG and GGN repeats in androgen receptor gene were associated with increased risk of prostate cancer, especially in Caucasians. PMID: 28091563 Knockdown of beta-Klotho produced the opposite effects. In conclusion, beta-Klotho inhibits EMT and plays a tumorsuppressive role in prostate cancer (PCa) , linking FGF/FGFR/beta-Klotho signaling to the regulation of PCa progression. PMID: 29749458 The interaction of AR and SP1 contributes to regulate EPHA3 expression. PMID: 29917167 DHX15 regulates androgen receptor (AR) activity by modulating E3 ligase Siah2-mediated AR ubiquitination independent of its ATPase activity promoting prostate cancer progression. PMID: 28991234 The interaction of Nanog with the AR signaling axis might induce or contribute to Ovarian cancer stem cells regulation. In addition, androgen might promote stemness characteristics in ovarian cancer cells by activating the Nanog promoter PMID: 29716628 a significant subset of endometrial cancers express androgen receptor especially a serous cancers. PMID: 29747687 Letter: eradication of androgen receptor amplification, PSA decline, and clinical improvement with high dose testosterone therapy. PMID: 28040353 The results in this meta-analysis indicated that AR CAG and GGN repeat polymorphisms may be an important pathogenesis of cryptorchidism. PMID: 29044734 the inverse relation observed between bone cell activity and tumor cell AR activity in prostate cancer bone metastasis may be of importance for patient response to AR. PMID: 29670000 Length variations of (CAG)n and (GGC)n polymorphism in the transactivation domain of AR, significantly influence hormonal profile, semen parameters, and sexual functions of asthenospermic subjects by down regulating the expression of AR mediating signaling. PMID: 29083935 Data suggest that somatic mosaicism in AR can cause partial androgen insensitivity syndrome. [CASE REPORT] PMID: 29267169 These results identify HoxB13 as a pivotal upstream regulator of AR-V7-driven transcriptomes that are often cell context-dependent in CRPC, suggesting that HoxB13 may serve as a therapeutic target for AR-V7-driven prostate tumors. PMID: 29844167 TRX1 is an actionable castration-resistant prostate cancer therapeutic target through its protection against AR-induced redox stress. PMID: 29089489 these findings reveal AR-genomic structural rearrangements as important drivers of persistent AR signalling in castration-resistant prostate cancer. PMID: 27897170 AR+ was associated with lower breast cancer mortality in the overall study population ( estrogen receptor-negative). PMID: 28643022 nuclear COBLL1 interacts with AR to enhance complex formation with CDK1 and facilitates AR phosphorylation for genomic binding in castration-resistant prostate cancer model cells. PMID: 29686105 A variety of AR mutants are induced under selective pressures of AR pathway inhibition in castration resistant prostate cancer which remain sensitive to the inhibitor darolutamide. PMID: 28851578 c.3864T>C AR novel mutation is responsible for complete androgen insensitivity syndrome [case report] PMID: 29206494 The Spinal and bulbar muscular atrophy is caused by the expansion of a CAG/glutamine tract in the amino-terminus of the androgen receptor PMID: 29478604 Polysomic AR genes show low methylation levels and high AR protein expression on immunohistochemistry PMID: 29802469 Oral administration of RAD140 substantially inhibited the growth of AR/ER(+) breast cancer patient-derived xenografts (PDX). Activation of AR and suppression of ER pathway, including the ESR1 gene, were seen with RAD140 treatment. PMID: 28974548 The aims of this study was to evaluate if extreme CAG and GGN repeat polymorphisms of the androgen receptors influence body fat mass, its regional distribution, resting metabolic rate, maximal fat oxidation capacity and serum leptin, free testosterone and osteocalcin in healthy adult men PMID: 29130706 The CRISPR/Cas9 system was able to edit the expression of AR and restrain the growth of androgen-dependent prostate cancer cells in vitro, suggesting the potential of the CRISPR/Cas9 system in future cancer therapy. PMID: 29257308 A new mechanism for complete androgen insensitivity syndrome (CAIS). A deep intronic pseudoexon-activating mutation in the intron between exons 6 and 7 of AR, detected in two siblings with CAIS, leads to aberrant splicing of the AR mRNA and insufficient AR protein production. PMID: 27609317 In the current work, we have confirmed that the lead androgen receptor DBD inhibitor indeed directly interacts with the androgen receptor DBD and tested that substance across multiple clinically relevant castration-resistant prostate cancer cell lines PMID: 28775145 Androgen receptor CAG repeat polymorphism is not associated with insulin resistance and type 2 diabetes in Sri Lankan males. PMID: 29202793 AR gene CAG repeat polymorphisms are associated with the increased risk of mild endometriosis PMID: 28915409 ARE full sites generate a reliable transcriptional outcome in AR positive cells, despite their low genome-wide abundance. In contrast, the transcriptional influence of ARE half sites can be modulated by cooperating factors. PMID: 27623747 Targeting the Malat1/AR-v7 axis via Malat1-siRNA or ASC-J9 can be developed as a new therapy to better suppress enzalutamide-resistant prostate cancer progression. PMID: 28528814 High circulating AR-V7 levels predicted resistance to abiraterone and enzalutamide in castration-resistant prostate cancer. PMID: 28818355 Results identified the N-terminal region of AR-V7 (splice variants) that interacts with the diffuse B-cell lymphoma homology (DH) domain of Vav3 which increases its expression in castration-resistant prostate cancer (CRPC). PMID: 28811363 The single nucleotide polymorphism G1733A of the androgen receptor gene is significantly associated with recurrent spontaneous abortions in Mexican patients. PMID: 28707146 AR can directly regulate cellular growth and control signaling pathways in castration-resistant prostate cancer cells. PMID: 27641228 Report increased androgen receptor gene copy number and protein expression in treatment-naive prostate cancer. PMID: 28052297 This review focuses on AR variants signaling pathways and their role in resistance to castration and prostate cancer progression. [review] PMID: 28945566 Here the authors show that the AF-1 domain of AR is bound by the cochaperone Bag-1L. PMID: 28826504 based on this assay, AR-LBD mutations such as F877L and T878A are not common contributors to de novo or acquired resistance to apalutamide PMID: 28633425 Here, the authors show that action of activated AR partitions into fractions that are controlled preferentially by different coregulators. In a 452-AR-target gene panel, each of 18 clinically relevant coregulators mediates androgen-responsiveness of 0-57% genes and acts as a coactivator or corepressor in a gene-specific manner. PMID: 28826481 Mechanistically, AR modulated cytokine CXCL5 expression by altering AKT --> NF-kappaB signaling, and interruption of AKT --> NF-kappaB --> CXCL5 signaling using either specific inhibitors or siRNA suppressed AR-enhanced EC recruitment and AR-EC-promoted RCC progression. PMID: 27848972 At 12 moths, men with 22-23 CAG presented with a statistically significantly lower sperm concentration than those with other CAG numbers following testicular germ cell cancer treatment PMID: 27873769 Data show that androgen receptor variant AR-V9 (AR-V9) may play a significant role in promoting androgen-independent growth of castration-resistant prostate cancer (CRPC) cells, and that AR-V9 mRNA expression in CRPC metastases was predictive of primary resistance to abiraterone acetate. PMID: 28473535 Alterations in the androgen receptor are associated with endocrine treatment outcomes in castration-resistance prostate cancer. PMID: 28104311 there is association between the AR CAG repeat polymorphism and ovarian cancer risk (Meta-Analysis). PMID: 28250337 Prostate cancer cells expressing an S273A mutant of CHIP have attenuated AR degradation upon 2-ME treatment compared with cells expressing wild-type CHIP, supporting the idea that CHIP phosphorylation by Aurora A activates its E3 ligase activity for the AR PMID: 28536143 CDK2 contributes to S81-AR phosphorylation and transactivation while CDK4 was not shown to be involved in this process. PMID: 29157894 Data show that androgen receptor (AR) status was significantly associated with brain metastasis in epithelial ovarian cancer (EOC). PMID: 28467804 Wild-type and mutant AR physically interact with the APC/CCdh1 complex in a ligand-dependent fashion without being targeted for proteasomal degradation. PMID: 27312068 HER2(+) and triple-negative breast cancer cell lines were treated with AR antagonist plus anti-HER2 mAb trastuzumab or mTOR inhibitor everolimus..AR antagonists synergize with FDA-approved breast cancer therapies such as everolimus and trastuzumab through distinct mechanisms. Treatment combinations are effective in trastuzumab-resistant HER2(+) breast cancer cells in vivo PMID: 28468774 Data indicate that androgen receptor serine515 (AR-515) is a potential prognostic marker and therapeutic target for triple negative breast cancer (TNBC). PMID: 28415597 High concentrations of DINCH urinary metabolites activate human androgen receptors. PMID: 29421333 men carrying shorter (<22) AR CAG repeats have lower HDL-C level and increased risk of hypertension. The androgenic activity may differ due to the polymorphic length of CAG repeats of the AR gene. PMID: 28295444 Inhibition of endogenous miR-30b-3p and miR-30d-5p enhanced AR expression and androgen-independent cell growth. PMID: 27683042 Our analysis, conducted among more than 17,000 women with early-stage breast cancer included in clinical and gene expression analysis, demonstrates that AR positivity is associated with favorable clinical outcome. PMID: 28151718 Study highlights how androgen receptor itself functions is an important step in elucidating the molecular basis for androgen-independent prostate tumors.Translocation of AR to improper gene promoter elements or DNA-binding sites can result in an alteration in gene expression and thus normal prostate function. AR regulation of mir-206 is an important mechanism for prostate tumor progression. [review] PMID: 28598253 The progesterone receptor B (PRB) and androgen Receptor (AR) mRNA levels were highest in tumors. PMID: 29491078 Findings provide the first evidence for a link between the androgen receptor gene and moral judgment and highlight the role of androgens in moral foundations. PMID: 28324702 Patients with circulating tumor cells that had AR-V7 protein in the cellular nuclei were very likely to survive longer on taxane-based chemotherapy. PMID: 27979426 the deregulation of androgen receptor (AR) expression is a driver of chromatin relaxation and that AR/androgen-regulated bromodomain-containing proteins (BRDs) mediate this effect. PMID: 28591577 Differential expression of miR-34b and androgen receptor are associated with prostate cancer aggressiveness in African-Americans and Caucasians. PMID: 28039468 AR and AR-related gene expression could be utilized to predict the prognosis of metastatic breast cancer. PMID: 28060723 Studies indicate that androgen receptor (AR) signaling differentially regulates proliferation of prostatic epithelia cells through mechanisms involving stromal/epithelial interactions. PMID: 27611945 These findings suggest that calpain and AR-V7 may serve as important biomarkers in the treatment of castration-resistant prostate cancer , and targeting calpain and AR-V7 may provide a new approach in overcoming docetaxel-resistance. PMID: 28498452 With respect to competitiveness, whereas the number of CAG repeats was not associated with the choice to compete, a lower number of CAG repeats was related to greater confidence in those who chose to compete, but this effect was attributable to the polymorphism's effect on actual performance. PMID: 27702564 DNAH8 has a role in androgen receptor activity and prostate cancer progression PMID: 27363033 A novel nonsense mutation in androgen receptor confers resistance to CYP17A1 inhibitor treatment in prostate cancer. PMID: 28036278 Social selection favors offspring prone to the development of androgenetic alopecia due to the length of the CAG repeat located in the androgen receptor gene on the X chromosome. PMID: 29254307 We demonstrated that the AR-miR-1 axis negatively regulates the novel oncogenic factor, TCF7. Dysregulation of TCF7 promoted a survival advantage and resistance to androgen deprivation, suggesting its therapeutic potential for castration-resistant prostate cancer. PMID: 28220803 Study show that phosphorylation of AR at Ser-578 is strongly associated with PKC expression. Also, the expression of pARS578 in hormone-naive prostate cancer was observed to be a negative prognostic marker associated with decreased survival from biochemical relapse and decreased disease-specific survival. These results suggest that PKC driven AR phosphorylation may promote prostate cancer progression. PMID: 27902483 We identified a molecular signature of secreted proteins associated with AA ultraresponsiveness and sustained AR/GR signaling upon AA resistance in intermediate or minimal responders. These data will inform development of noninvasive biomarkers predicting AA response and suggest that further inhibition along the AR/GR signaling axis may be effective only in AA-resistant patients who are intermediate or minimal responders PMID: 27993966 Androgen receptor transcriptionally regulates semaphorin 3C in a GATA2-dependent manner in prostate tumor cells. PMID: 28038451 Castration resistant prostate cancer progression is facilitated via Src-induced sensitization of AR to intracrine androgen levels, resulting in the engagement of canonical and non-canonical ARBS-dependent gene signatures. PMID: 28055971 A large proportion of metastatic endometrial cancer lesions express AR, which may be a potential target in these patients PMID: 27384477 Report a significant survival benefit in lung adenocarcinoma patients with positive expression of one of the investigated hormonal receptors: androgen receptor, estrogen receptor-alpha or progesterone receptor. PMID: 27690341 AR activation correlates with Cisplatin resistance presumably via modulating NF-kappaB activity in bladder cancer cells PMID: 27322140 PC-1 works in conjunction with E3 ligase CHIP to regulate androgen receptor stability and activity. PMID: 27835608 Despite increased androgen synthesis inhibition, we demonstrate that tumor AR axis remains important in disease progression. We highlight that abiraterone metabolism and pharmacokinetics may play a role in resistance. PMID: 27683182 Immunohistochemical analyses of tissue microarrays from benign human tissues confirmed expression of AR in endothelial cells from several androgen-regulated and non-androgen-regulated human organs. PMID: 27679502 Data show that phosphorylated forms of nucleophosmin 1 (NPM1) interact with androgen receptor (AR) in nucleoplasm. PMID: 26993766 We show AR expressed in cancer-associated fibroblasts (CAFs) contributes to the tumor-promoting abilities that CAFs exert on epithelial prostate cancer cells. Further, we found that decreased AR expression in CAFs is also associated with an increase in stem cell marker gene expression in prostate cancer epithelial cells. PMID: 28264911 Within an institutional cohort, the RNA ISH assay identified AR-V7 within FFPE tissue and may have prognostic value in metastatic castration-sensitive prostate cancer. These preliminary findings warrant further study in larger cohorts. PMID: 27440270 increases hematogenous metastasis yet decreases lymphatic metastasis of renal cell carcinoma through differential regulation of VEGF-A vs. VEGF-C via miR-185-5p PMID: 29030639 Data show that enzalutamide resistance was accompanied by increased androgen receptor (AR) mRNA and protein expression as well as AR gene amplification. PMID: 27486973 Show More Hide All
Involvement in disease	Androgen insensitivity syndrome (AIS); Spinal and bulbar muscular atrophy X-linked 1 (SMAX1); Androgen insensitivity, partial (PAIS)
Subcellular Location	Nucleus, Cytoplasm
Protein Families	Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity	Isoform 2 is mainly expressed in heart and skeletal muscle (PubMed:15634333). Isoform 3 is expressed by basal and stromal cells of prostate (at protein level) (PubMed:19244107).
Database Links	HGNC: 644 OMIM: 300068 KEGG: hsa:367 STRING: 9606.ENSP00000363822 UniGene: Hs.76704

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP001975HU
Size	US$1726Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Androgen receptor(AR) ,partial

Product Details

Related Products

Q&A and Customer Reviews

Target Data

Most popular with customers

CloseMessage

×CloseMessage