Recombinant Mouse Neuronal proto-oncogene tyrosine-protein kinase Src (Src)

Code CSB-YP022650MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022650MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022650MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022650MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022650MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Src; Neuronal proto-oncogene tyrosine-protein kinase Src; EC 2.7.10.2; Proto-oncogene c-Src; pp60c-src; p60-Src
Species
Mus musculus (Mouse)
Expression Region
2-541
Target Protein Sequence
GSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEPK LFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDV REGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFL VRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKH ADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVA IKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGE TGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLD QVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protein-coupled receptors as well as cytokine receptors. Participates in signaling pathways that control a diverse spectrum of biological activities including gene transcription, immune response, cell adhesion, cell cycle progression, apoptosis, migration, and transformation. Due to functional redundancy between members of the SRC kinase family, identification of the specific role of each SRC kinase is very difficult. SRC appears to be one of the primary kinases activated following engagement of receptors and plays a role in the activation of other protein tyrosine kinase (PTK) families. Receptor clustering or dimerization leads to recruitment of SRC to the receptor complexes where it phosphorylates the tyrosine residues within the receptor cytoplasmic domains. Plays an important role in the regulation of cytoskeletal organization through phosphorylation of specific substrates such as AFAP1. Phosphorylation of AFAP1 allows the SRC SH2 domain to bind AFAP1 and to localize to actin filaments. Cytoskeletal reorganization is also controlled through the phosphorylation of cortactin (CTTN). When cells adhere via focal adhesions to the extracellular matrix, signals are transmitted by integrins into the cell resulting in tyrosine phosphorylation of a number of focal adhesion proteins, including PTK2/FAK1 and paxillin (PXN). In addition to phosphorylating focal adhesion proteins, SRC is also active at the sites of cell-cell contact adherens junctions and phosphorylates substrates such as beta-catenin (CTNNB1), delta-catenin (CTNND1), and plakoglobin (JUP). Another type of cell-cell junction, the gap junction, is also a target for SRC, which phosphorylates connexin-43 (GJA1). SRC is implicated in regulation of pre-mRNA-processing and phosphorylates RNA-binding proteins such as KHDRBS1. Also plays a role in PDGF-mediated tyrosine phosphorylation of both STAT1 and STAT3, leading to increased DNA binding activity of these transcription factors. Involved in the RAS pathway through phosphorylation of RASA1 and RASGRF1. Plays a role in EGF-mediated calcium-activated chloride channel activation. Required for epidermal growth factor receptor (EGFR) internalization through phosphorylation of clathrin heavy chain (CLTC and CLTCL1) at 'Tyr-1477'. Involved in beta-arrestin (ARRB1 and ARRB2) desensitization through phosphorylation and activation of GRK2, leading to beta-arrestin phosphorylation and internalization. Has a critical role in the stimulation of the CDK20/MAPK3 mitogen-activated protein kinase cascade by epidermal growth factor. Might be involved not only in mediating the transduction of mitogenic signals at the level of the plasma membrane but also in controlling progression through the cell cycle via interaction with regulatory proteins in the nucleus. Plays an important role in osteoclastic bone resorption in conjunction with PTK2B/PYK2. Both the formation of a SRC-PTK2B/PYK2 complex and SRC kinase activity are necessary for this function. Recruited to activated integrins by PTK2B/PYK2, thereby phosphorylating CBL, which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function. Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase. Phosphorylates DDR2 on tyrosine residues, thereby promoting its subsequent autophosphorylation. Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-738'. Enhances DDX58/RIG-I-elicited antiviral signaling. Phosphorylates PDPK1 at 'Tyr-9', 'Tyr-373' and 'Tyr-376'. Phosphorylates BCAR1 at 'Tyr-226'. Phosphorylates CBLC at multiple tyrosine residues, phosphorylation at 'Tyr-341' activates CBLC E3 activity. Involved in anchorage-independent cell growth. Required for podosome formation. Mediates IL6 signaling by activating YAP1-NOTCH pathway to induce inflammation-induced epithelial regeneration.
Gene References into Functions
  1. Src kinase activation by nitric oxide promotes resistance to anoikis in tumor cell lines. PMID: 29651879
  2. RANKL and Src has an unrecognized role in osteocyte survival. PMID: 28589412
  3. These interactions are required for SRC-induced activation of VAV and the subsequent engagement of a JIP1-tethered JNK signaling module. PMID: 28930674
  4. Elevated retinoic acid-inducible gene 1 (RIG-I) modulated the interaction of activated proto-oncogene c-Src (Src) and STAT3 by competitive binding to STAT3. PMID: 27349479
  5. Cbl, Cbl-b, and Cbl-c have a role in protecting mammary epithelial cellsfrom proteotoxic stress-induced cell death by promoting turnover of active c-Src PMID: 27930322
  6. unlike c-fos-/- mice, c-src-/- mice demonstrated activated, mature osteoblasts, and parallel layers of cement lines in the superficial bone matrix, indicating the new bones were piled up to older bone. PMID: 28442663
  7. TM, especially TME45, maintains vascular integrity, at least in part, via Src signaling. PMID: 27643869
  8. We conclude that pp60(Src) can directly inhibit DDAH II and this is involved in the increased ADMA levels that enhance eNOS uncoupling during the development of acute lung injury (ALI). PMID: 27838434
  9. Ambra1 binds to both FAK and Src in cancer cells. When FAK is present, Ambra1 is recruited to focal adhesions, promoting FAK-regulated cancer cell direction-sensing and invasion. However, when Ambra1 cannot bind to FAK, abnormally high levels of phospho-Src and phospho-FAK accumulate at focal adhesions, positively regulating adhesion and invasive migration. PMID: 28362576
  10. Thus we propose that Cx43 might enhance the activation of Nrf2/ARE pathway by means of inhibiting c-Src activity to hinder the nuclear export of Nrf2, and then reduce expression of FN, ICAM-1 and TGF-b1, ultimately attenuating renal fibrosis in diabetes. PMID: 27840317
  11. Osteoprotegerin may induce podosome reassembly and peripheral adhesive structure detachment by modulating phosphorylation of Pyk2 and Src and their intracellular distribution in osteoclasts. PMID: 26743491
  12. BMP2 also requires Src for filamentous actin polymerization in Tgfbr3(-/-) epicardial cells. PMID: 26645362
  13. v-Src prevents nuclear exclusion of YAP through a decrease in the phosphorylation of YAP at Ser127 in multinucleated cells. PMID: 27871934
  14. These results revealed that vascular sprouting and permeability are both controlled through the VEGFR2-TSAd-c-Src signaling pathway in a subset of tissues, which may be useful in developing strategies to control tissue-specific pathological angiogenesis. PMID: 27436360
  15. The TBK1 Y179A mutant failed to rescue type I IFN production by virally infected RAW264.7 macrophages deficient in TBK1. PMID: 28049762
  16. identified both Syk and Src signaling pathways as ones that participate in Borrelia burgdorferi phagocytosis and the resulting cytokine activation. PMID: 28717031
  17. results indicate that SRC likely plays a central role in regulating multiple unique signaling pathways activated by MTB infection PMID: 23824656
  18. c-Src tyrosine kinase mediates high glucose-induced endothelin-1 expression PMID: 27102411
  19. PTPN2 is a positive regulator of lipopolysaccharide-induced inflammatory response by enhancing the activity of Src through targeting the inhibitory phosphor-tyrosine527 of Src. PMID: 27611995
  20. demonstrated that both IL-10 and TGF-beta upregulated TIM-3 surface expression on dendritic cells via a common signaling pathway that involved sequential activation of c-Src and Bruton's tyrosine kinase PMID: 27439518
  21. Results suggest that interleukin-6 (IL-6) increases VEGF-C induction and lymphangiogenesis may involve, at least in part, Src-FAK-STAT3 cascade in lymphatic endothelial cells (LECs). PMID: 27383632
  22. Transcriptional signature induced by a metastasis-promoting c-Src mutant in a human breast cell line has been reported. PMID: 26919036
  23. Data show that the essential oil (EO) decreased focal adhesion and invadopodia formation which was accompanied by a drastic downregulation of focal adhesion kinase (FAK) and proto-oncogene protein Src. PMID: 26477879
  24. miR-222-3p serves as an inhibitor of osteoclastogenesis and c-Src mediates its inhibition of cathepsin K and TRAP. PMID: 26891296
  25. results suggest that LPS-stimulated macrophage mediators attenuate both FAK and Src activations in osteoblast, suggesting a novel role for TNFalpha on osteoblast performance PMID: 24164869
  26. Src has a role in priming Pyk2 (but not FAK) phosphorylation and subsequent activation downstream of integrins PMID: 26866924
  27. Heritable pulmonary arterial hypertension (PAH) results from increased SRC activation, cellular contraction, and vascular resistance, but antagonism of HTR2B prevents SRC phosphorylation and development of PAH. PMID: 26863209
  28. Periodic axial motility of epithelial basal cell projections is controlled by c-Src. PMID: 26868824
  29. mutation of the five Src-modified residues to aspartate but not phenylalanine allows Runx1 to increase Cebpa and granulocyte colony formation by Runx1-deleted murine marrow. PMID: 26598521
  30. This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells. PMID: 26011449
  31. Src/Syk-dependent signalling stabilises platelet adhesion to podoplanin PMID: 25694214
  32. FAK-regulated signalling module PDK1-Akt-p70S6K that controls Src's intracellular trafficking operates at Src-containing autophagosomes. PMID: 26071201
  33. The presented evidence endeavors to highlight the influence of SFK up-regulation on an extensive number of hematological malignancies and the need to consider them as candidates in targeted anticancer therapy. PMID: 24898666
  34. suggest that Reelin-dependent signaling mechanisms may be split into Src-AKT-dependent and Src-Go-dependent pathways PMID: 26441085
  35. Src contributed to tyrosine phosphorylation of ELMO1 at Y720 and Y724 residues, which was crucial for activation of Rac1, followed by the promoting cell adhesion, spreading, and migration. PMID: 26205662
  36. c-Src signaling modulates osteoblast differentiation at least in part through phosphorylation of Osterix. PMID: 25802190
  37. decreased FXIII-A levels in caveolae after NC9 treatment increased c-Src activation, resulting in caveolin-1 phosphorylation, homo-oligomerization and Akt phosphorylation, suggesting cellular FXIII-A has a role in regulating c-Src signaling in osteoblasts PMID: 26231113
  38. These results suggest that phloretin was an inhibitor of actin podosomes and sealing zone, disrupting alpha5beta3 integrin-c-Src-Pyk2/Syk signaling pathway for the regulation of actin cytoskeletal organization in osteoclasts. PMID: 25834823
  39. These findings provide a new insight into VEGF and c-Src mode of reaction in triggering destructive repair of osteonecrosis. PMID: 25554601
  40. Our results provide evidence that cSrc is activated downstream of PKA and that inhibition of its activity blocks the capacitation-induced hyperpolarization of the sperm plasma membrane . PMID: 26060254
  41. findings demonstrate c-Src function is necessary and sufficient for triggering microglia proinflammatory signature, glutamate release, microglia-induced neuronal loss, and phagocytosis PMID: 25421817
  42. activation of SLK by haptotactic signals requires its recruitment to the leading edge by LMO4 in a Src-dependent manner. PMID: 25882817
  43. These data define, for the first time, the requirement of AFAP1 for the spatial and temporal regulation of cSrc activity in the normal breast, specifically for milk production. PMID: 25043309
  44. These data identify critical, yet potentially opposing roles played by various SFKs in the initiation and metastatic potential of prostate cancer. PMID: 25053806
  45. Ca2+-PYK2-Src-NFATc1 signaling pathways are attenuated by polyamines that inhibit the migration of preosteoclasts PMID: 25216923
  46. Activation of mGluR1 facilitates firing of molecular layer interneurons through the TRPC1-mediated inward current, which depends on not only G protein-dependent but also Src-ERK1/2-dependent signaling pathways. PMID: 25181481
  47. Src phosphorylation converts Mdm2 from a ubiquitinating to a neddylating E3 ligase. PMID: 25624478
  48. These data suggest that heterozygous null BMPR2 mutations promote SRC-dependent caveolar trafficking defects in PECs and that this may contribute to pulmonary endothelial barrier dysfunction in Hereditary pulmonary arterial hypertension patients PMID: 25411245
  49. gp130 associates with the related tyrosine kinases Src and Yes, which are activated on receptor engagement to phosphorylate YAP and induce its stabilization and nuclear translocation PMID: 25731159
  50. Data indicate that Src kinase modulates the transit time of NEDD9 (neural precursor cell expressed developmentally down-regulated gene 9) at focal adhesion sites. PMID: 25059660

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor. Mitochondrion inner membrane. Nucleus. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Cell junction, focal adhesion.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, SRC subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1