Purity
            Greater than 85% as determined by SDS-PAGE.
           
                                                  
                                                  
                                        
                                                  
            Species
            Anopheles gambiae (African malaria mosquito)
           
                              
                              
            Expression Region
            162-713aa
           
                              
            Target Protein
              Sequence            
            DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESS
              Note: The complete
                sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
                translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
                
If the exact amino acid sequence of this recombinant protein is critical to your application,
                please explicitly request the full and complete sequence of this protein before ordering.
                          
           
                              
                              
                                        
            Tag Info
            
                                          C-terminal 6xHis-tagged
                          
           
                              
            Form
            
                            Liquid or Lyophilized powder                             
              Note: We will preferentially ship the format that
                we have in stock, however, if you have any special requirement for the format, please remark your
                requirement when placing the order, we will prepare according to your demand.
                          
           
                    
            Buffer
                          If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
              
              Note: If you have any special requirement for the
                glycerol content, please remark when you place the order.
              
              If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
              6% Trehalose.
                          
           
                                                  
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
             Basically, we can dispatch the products
              out in 1-3
              working days after receiving your orders. Delivery time may differ from different purchasing way or
              location, please kindly consult your local distributors for specific delivery time.
              Note: All of our proteins are default shipped with
                normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
                and extra fees will be charged.            
           
                    
            Notes
            Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
           
                    
            Datasheet & COA
             Please contact us to get it.