Recombinant Rat Myelin and lymphocyte protein (Mal)

Code CSB-CF727063RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Mal
Uniprot No.
Alternative Names
Mal; Mvp17; Myelin and lymphocyte protein; 17 kDa myelin vesicular protein; MVP17; NS 3; T-lymphocyte maturation-associated protein
Species
Rattus norvegicus (Rat)
Expression Region
1-153
Target Protein Sequence
MAPAAASGGSTLPSGFSVFVTFPDLLFIFEFIFGGLVWILIASSLVPMPLVQGWVMFVSV FCFLATTSLMVMYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATITMFDGFTYR HYHENIAAVVFAYVATLLYVIHAVFSLIRWKSS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function.
Gene References into Functions
  1. Data suggest that expression of MAL in cells confers both ETX (Clostridium perfringens epsilon-toxin) binding and susceptibility to ETX-mediated cell death; cells expressing rat MAL are 100 times more sensitive to ETX than cells expressing human MAL. PMID: 25993478
  2. Significant upregulation of MAL in the retinal ganglion cells after optic nerve crush was found. PMID: 24878628
  3. this is the first description of MAL expression changes in gray matter after spinal cord injury. Our results prompted that MAL might participate in CNS pathophysiology after SCI. PMID: 23196718
  4. MAL, but not MAL2, self-associates with higher-order cholesterol-dependent complexes with apical proteins and promotes the formation of detergent-resistant membranes that recruit apical proteins. PMID: 21732912
  5. Loss of MAL expression is aasociated with precancerous lesions of the esophagus PMID: 17151798

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MAL family
Tissue Specificity
Exclusively expressed in white and gray matter oligodendrocytes in the CNS and in myelinating Schwann cells in peripheral nerves. Higher levels are found in the PNS than in the CNS or spinal cord, in the gray matter than in the white. Weak expression also
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1