Code | CSB-EP355969HEM |
Abbreviation | Recombinant Hepatitis B virus genotype D subtype ayw protein X |
MSDS | |
Size | US$388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
In the general approach to express the recombinant Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) Protein X, a plasmid encoding the Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) Protein X (1-154aa) is first constructed. The constructed plasmid is then introduced into e.coli cells. Plasmid-containing e.coli cells are screened and cultured under conditions that induce the protein expression. The protein is fused with a N-terminal 6xHis-SUMO tag. Lysing the cultured cells and purifying the resulting recombinant Protein X through affinity purification. The SDS-PAGE analysis is conducted to confirm the presence of the recombinant Protein X and assess its purity. Its purity is over 90%.
There are currently no reviews for this product.
We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-EP355969HEM His
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA