Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)

Code CSB-CF304836PQE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P69610
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)
Sequence MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV
Source in vitro E.coli expression system
Gene Names E
Protein Names Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): ORF 3 Protein 4 Protein X1
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the viral envelope that plays a central role in virus morphogenesis and assembly. It is sufficient to form virus-like particles. Seems to be important for creating the membrane curvature needed to acquire the rounded, stable and infectious particle phenotype. Acts as a viroporin, inducing the formation of hydrophilic pores in cellular membranes. Also induces apoptosis (By similarity).
Subcellular Location Virion membrane, Single-pass type III membrane protein, Host Golgi apparatus membrane, Single-pass type III membrane protein
Protein Families Alphacoronaviruses E protein family

Related Products

E Proteins

E Proteins for Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.