Tel : 301-363-4651
All
  • All
  • Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Raw Material For IVD Kit

CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits

SARS-CoV-2: Nucleoprotein｜Spike protein｜S (RBD) protein｜N Antibody｜S Antibody｜N IgG Ab ELISA Kit

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

Code CSB-YP333052BJO
Size US$335
Image
  • SDS-PAGE- Recombinant protein Bovine S
    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names S
Uniprot No. P25194
Research Area Others
Alternative Names S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']
Species Bovine coronavirus (strain vaccine) (BCoV) (BCV)
Source Yeast
Expression Region 326-540aa
Target Protein Sequence PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 25.7kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting
and FAQs		 Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Related Products

S antibodies

S Proteins

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection.
Subcellular Location Spike protein S2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly, Some S oligomers may be transported to the plasma membrane, where they may mediate cell-cell fusion (By similarity), SUBCELLULAR LOCATION: Spike protein S1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Peripheral membrane protein
Protein Families Betacoronaviruses spike protein family
Promotions
Contact Us

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
TWIK2 channel mediates inflammation, study finds The Overview of Gastric Cancer Neutralizing Antibody Stands Out Among Antiviral Therapies SWISS-PROT: When and How to Use It Osteoprotegerin (OPG): What is Its Potential as a Biomarker or Therapeutic Target? Endometrial Cancer, a Female Killer That is Easily Ignored Melanoma, the Most Serious Type of Skin Cancer Multiple Myeloma, One of High-Risk Factors for COVID-19 Non-Hodgkin's Lymphoma, One of Common Heterogeneous Malignant Tumors Information You Must Know about KCNN4 STAT3: a Key Transcriptional Regulator in Cancer Streptococcus pneumoniae, a Primary Cause of Pneumonia The True Face of Tumor Suppressor Gene p53 MUC16 (CA125): a Promising Predictive Marker and Therapeutic Target in Cancer Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy ROR1, an Emerging Target for Tumor Immunotherapy TNFR1: A Multifaceted Molecule in Cancer, Another Promising Therapeutic Target for COVID-19 NRG1 or NRG1 Fusions: an Intriguing Therapeutic Target in Diseases Dual Role of TNFRSF14 in Immunology Learn to Distinguish Moles from Melanomas With the High Potential in Cancer Immunotherapy, CD40 Is Triggering Attention CD31- A Complex Function Molecule CD14-- A Membrane Receptor for Bacterial Lipopolysaccharides Surface Markers That Help You Identify Lymphocytes ERBB3/HER3: a New Target for Tumor Therapy, a Driver Gene of Multi-Tumors How Do You Get Exosomes? Cell Differentiation Determines the Fate of Cells CD73, What a Powerful Therapy Target in Tumor Immune CAR-T Cell Therapy- An Useful Treatment To Cancer Cervical Cancer, One of the Most Common Killers of Women CD19-The Most Popular Target with CAR T-Cell Therapy A Resume for Transmembrane Proteins Ovarian Cancer -- The Silent Killer G protein-Coupled Receptor - Targets for Drug Therapy Differentiation of Th17 Cells Tag Antibodies, Your Good Partner in Protein Research How to Choose the Loading Control Antibodies? Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody Chemokine Receptors – One Kind of Powerful Seven Transmembrane Spanning G Protein-coupled Receptor How to Choose the Right Secondary Antibody? A transport machine -- ATP-binding cassette Glial Fibrillary Acidic Protein - Astrocyte Specific Marker New Mechanism, NRP1 Enhances the Ability of SARS-CoV-2 Infection Surface Markers of Mesenchymal Stem Cells Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Understanding Hepatitis, Fighting Hepatitis Leukemia, Why is it So Common? Biological Activity of Proteins Bladder Cancer, A Malignancy that Favors Men The Metabolic Phenotype of Tumor-Associated Macrophages in the Tumor Microenvironment Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase The Rare Disease-Huntington's Disease Nanobody, what a Powerful Novel Antibody! CD147, a New Target of SARS-CoV-2 Invasion One World, One Hope——What Can We Do about AIDS? The Application of IHC in Pathological Diagnosis LPS/TLR4 Signal Transduction Pathway What You Have to Know about Cytokine Storm and Virus Infection Toll-like Receptors--The Eye of Innate Immunity The difference between primary antibody and secondary antibody Ice Bucket Challenge – Pay your attention to amyotrophic lateral sclerosis CD46, A Complement Regulator Human Leukocyte Antigen: Distinguish between Friend and Foe Do you Often Trouble in These Problems of ELISA? The Meaning of Irregular Antibody Screening What Factors Could Affect ELISA Results? CD47, A New Target for Tumor Immune A "trembling" Parkinson's Disease What Are Immune Checkpoints? What Is Immune Checkpoint Therapy? What Are Immune Checkpoint Inhibitors? What Are Immune Checkpoint Proteins? Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Hematopoietic Stem Cell Surface Marker Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Overview of Coagulation Understanding of Serum Albumin Kinase Classification The Overview of Hippo Signaling Pathway What You Should Know The Common Sense of Neurodegeneration A Switch that Controls the Entry and Exit of Ions The Recently Emerged New Swine Influenza Virus -- G4 EA-H1N1 CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research How do Th1 and Th2 Cells Differentiate? CD22- What A Powerful Co-receptor of B Cell Receptor What Powerful Model Organism Databases TCGA Database- A Good Partner of Researchers What a Powerful Artifact of DNA Compression - Histone Epigenetic Histone Modifications Pathway How Does Histone Modification Affect Gene Expression? How to Measure Histone Modification? Histone modification and Cancer Four Common Histone Modifications Identify Treg Cells. You Can Do This. The Multifunctional Enzyme CD38: A Target for Immunotherapeutic Approaches in Cancer About Thyroid Tumor, This Information You Must Know! What A Paradoxical TNF Signaling Pathway-Based on Different Receptors Don't Let Hepatocellular Carcinoma What Are the Effects of Abnormalities in the ALK Gene These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker Introduction of Hepatocellular Carcinoma Related Signaling Pathways Mesothelin: A Rising Star of Cancer Immunotherapy Do You Really Know the Gonorrhea? Diabetes: What You Need to Know ACE2, The Hottest Target of SARS-CoV-2 Invasion PD-1-- An Important Immune Checkpoint Please Take It Seriously-Influenza Does TNF Superfamily Inhibit Cancer or Promote Its Development? TMPRSS2, an Activator for SARS-CoV-2 Invasion An Overview of CD226 and Its Promising Role in Cancer Immunotherapy TROP2-An Important Target for Cancer Treatment MOA1-A Potential Cancer Therapy Target CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer TASIN represents a promising approach for prevention of colorectal cancer Latest Changes in Journal Impact Factor Antibody ABTAA alters tumor blood vessels Surface Markers of Natural Killer Cells What Is an Antibody? Modified red blood cells prevents harmful immune response BMTP-11 found to delay progression of osteosarcoma Applications of recombinant proteins How to choose a suitable expression vector? How to express a protein with bioactivity? 11 tips for choosing your right ELISA kit The Overview of Chemokine General Information of Different Tags CUSABIO's Five Expression Systems Study provides clues to the role of PRMT5 in glioblastoma Lack of IL-33 contributes to Alzheimer's disease FAP may be a drug target for pancreatic cancer The Nature of Detergent and Its Application in Membrane Proteins A drug candidate holds promise in treating autism The Overview of Colony Stimulating Factors A TRPC5 inhibitor has therapeutic benefits for progressive kidney disease, study finds Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Apoptosis mediated by death receptor Inhibition of ASCT2 combats cancer in vitro and in vivo Aesthetic Appreciation of Apoptosis Signal Pathway The Application of Nanodiscs in Membrane Proteins PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration Itaconate is a negative regulator of inflammation The Memory thief - Alzheimer's disease The Overview of Growth Factor WAY-316606 will treat hair loss? Tumor Necrosis Factor (TNF) Role of non-coding RNA in prostate cancer progression The Overview of Interferon Tumor markers The Oncogene HER2: a New Target for Drug-Resistant Tumors A Group of Promising Proteins - Cell Cycle Markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy Four Types of ELISA How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display：Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis The Overview of Breast Cancer: Related Signaling Pathways, Therapeutic Targets The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? What You Have to Know about Exosomes CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
Related pathways
Virus Infection

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1