Code | CSB-YP333052BJO |
Size | US$335 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | S |
Uniprot No. | P25194 |
Research Area | Others |
Alternative Names | S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2'] |
Species | Bovine coronavirus (strain vaccine) (BCoV) (BCV) |
Source | Yeast |
Expression Region | 326-540aa |
Target Protein Sequence | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 25.7kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
|
Subcellular Location | Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. |
Protein Families | Betacoronaviruses spike protein family |