Home
Protein
Recombinant Protein
Recombinant Rabies virus Glycoprotein (G), partial

Recombinant Rabies virus Glycoprotein (G), partial

^{In Stock}

Code	CSB-EP365970RID
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365970RID could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365970RID could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P03524

Alternative Names

GGlycoprotein

Species

Rabies virus (strain PM) (RABV)

Source

E.coli

Expression Region

20-459aa

Target Protein Sequence

KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

65.5kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Rabies Virus Glycoprotein is a superior quality replication of the Glycoprotein from the Rabies virus (strain ERA). This protein, produced by the 'G' gene, plays a key role in the virus's life cycle, including viral entry and immune evasion. Our recombinant version is produced in E.coli and represents a partial sequence from the 20th to the 459th amino acid, making it a reliable choice for your related research endeavors.

Emphasizing quality and practicality, our Recombinant Rabies Virus Glycoprotein is N-terminal 6xHis-SUMO-tagged, allowing for an efficient purification and detection process. Rigorous testing has confirmed a purity level of over 90% as determined by SDS-PAGE. To cater to a variety of research needs, our product is available as a liquid or as a lyophilized powder, providing flexibility for your specific requirements.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I would like to know your opinion about endotoxin and aseptic removal if we will be using the protein HPLC method ?

Thanks for your inquiry.
Regarding CSB-EP365970RID, if you will only use this protein for HPLC analysis, we think it's not necessary to remove the endotoxin removal,only needs to perform aseptic processing, however, it depends on your decision.

We are looking for Rabies G protein antigen or G+N protein antigen if available. You have several strains for Rabies G protein listed on your website. What was the antigen used to generate the antibody cat# CSB-PA14899A0Rb.
Please send me details for the antigen, expression systems, sizes offered, cost and lead time

Very nice to receive your inquiry. The corresponding antigen for CSB-PA14899A0Rb is CSB-EP365970RID (20-459aa).
Code: CSB-EP365970RID
Name: Recombinant Rabies virus Glycoprotein(G),partial
Expression System: E.coli
Expression Region: 20-459aa; Partial; Virion surface domain
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

Delivery Form: Lyophilized Powder
Storage Buffer before Lyophilization: Lyophilized from a 0.2 μm filtered 10 mM Tris-HCl, 1 mM EDTA, pH 8.0
Note: If your order size matches with our stock amount, we could deliver Lyophilized Powder. If not, we suggest to deliver Liquid Form, supplied in 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.

Target Background

Function

Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.

Subcellular Location

Virion membrane; Single-pass type I membrane protein.

Protein Families

Lyssavirus glycoprotein family

Promotions