Recombinant Lassa virus Nucleoprotein (N)

Code CSB-YP318401LNP
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP318401LNP could indicate that this peptide derived from Yeast-expressed strain Mouse/Sierra Leone/Josiah/1976)(LASV) N.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP318401LNP could indicate that this peptide derived from Yeast-expressed strain Mouse/Sierra Leone/Josiah/1976)(LASV) N.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Others
Alternative Names
N; Nucleoprotein; EC 3.1.13.-; Nucleocapsid protein; Protein N
Species
strain Mouse/Sierra Leone/Josiah/1976)(LASV)
Source
Yeast
Expression Region
1-569aa
Target Protein Sequence
MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKKALGMFISDTPGERNPYENILYKICLSGDGWPYIASRTSITGRAWENTVVDLESDGKPQKADSNNSSKSLQSAGFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSTPRVVL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
65.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

For CSB-YP318401LNP, do you have any literature? Will the purity remain above 90%?

A:
Thanks for your inquiry.
1) We have found a literature reporting the crystal structure of the full-length NP of the LASV strain AV expressed in the recombinant baculovirus system. Here is the link:
http://www.jbc.org/content/286/44/38748.long
2) There is a literature reporting reporting the expression of the nuclear protein (NP) of Lassa fever virus (LASV) in E. coli and studying the crystal structure. Here is the link:
https://experts.umn.edu/en/publications/expression-and-x-ray-structural-determination-of-the-nucleoprotei
3) Another literature is a yeast two-hybrid assay to verify the interaction of this protein with host cells. Here is the link:
https://docs.lib.purdue.edu/surf/2017/presentations/32/
Would you please confirm what experiment you plan to perform so we could provide corresponding literature?
The purity will be greater than 90% as determined by SDS-PAGE.
Q:

Please can you provide sequence, availability and tag information for all available sizes of all available expression hosts?
I'm particularly interested in the nature of the tag present.

A:
Thanks for your inquiry.
Recombinant Lassa virus Nucleoprotein(N)
CSB-YP318401LNP >> Yeast
CSB-EP318401LNP >> E.coli
CSB-BP318401LNP >> Baculovirus
CSB-MP318401LNP >> Mammalian cell
Expression Region: 1-569aa; Full length.
Tag information:CSB-EP318401LNP: N-terminal 6xHis-SUMO-tagged; CSB-EP318401LNPe1: Tag-Free; YP: N-terminal 6xHis-tagged;
BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression system: BP, MP: N-terminal 6xHis-tagged
Target Protein Sequence:
Please view the full sequence on this page.
We can provide the detailed sequence information (including the tag sequence and target protein sequence) for successfully deveoped protein CSB-EP318401LNP and CSB-YP318401LNP, because the tags are confirmed.
For the other undeveloped proteins, as the tag type will be determined during the manufacturing process, so we can't provide the complete sequence.
CSB-EP318401LNP: N-terminal 6xHis-SUMO-tagged
The complete sequence is list as below: Tag sequence+Target protein sequence
Tag (N-terminal 6xHis-SUMO-tagged) sequence:

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT


CSB-YP318401LNP: N-terminal 6xHis-tagged
The complete sequence is list as below: Tag sequence+Target protein sequence
Tag (N-terminal 6xHis-tagged) sequence:
MDHHHHHHRT

Target Background

Function
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of host IRF3, a protein involved in interferon activation pathway, leading to the inhibition of interferon-beta and IRF3-dependent promoters activation. Encodes also a functional 3'-5' exoribonuclease that degrades preferentially dsRNA substrates and thereby participates in the suppression of interferon induction.
Gene References into Functions
  1. Importantly, authors demonstrate for the first time that Lassa virus nucleoprotein is involved in the inhibition of antigen-presenting cell-mediated NK cell responses. PMID: 25253342
  2. These results highlight the key role of nucleoprotein exonuclease domain function in the immune evasion that occurs during Lassa virus infection. PMID: 25253344
  3. NP trimerization is essential for transcription and/or replication of the viral genome. PMID: 23553456
  4. molecular dynamics (MD) simulations have been carried out to investigate the characters of deoxythymidine triphosphate binding to two forms of nucleoprotein. PMID: 22871039
  5. Structure of the Lassa virus nucleoprotein revealed by X-ray crystallography, small-angle X-ray scattering, and electron microscopy PMID: 21917929
  6. Residues D389 and G392 of nucleoprotein were critical for Lassa virus viability, while the D389A/G392A and D389T/392A double mutants were severely altered in the ability to suppress interferon in macrophages and dendritic cells. PMID: 21880754

Show More

Hide All

Subcellular Location
Virion. Host cytoplasm.
Protein Families
Arenaviridae nucleocapsid protein family
Database Links

KEGG: vg:956584

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*