Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-YP318401LNP |
| Abbreviation | Recombinant Lassa virus N protein |
| MSDS | |
| Size | $436 |
| Order now | |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
For CSB-YP318401LNP, do you have any literature? Will the purity remain above 90%?
Please can you provide sequence, availability and tag information for all available sizes of all available expression hosts?
I'm particularly interested in the nature of the tag present.
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT
KEGG: vg:956584